KEGG   Homo sapiens (human): 112398Help
Entry
112398            CDS       T01001                                 

Gene name
EGLN2, EIT6, HIF-PH1, HIFPH1, HPH-1, HPH-3, PHD1
Definition
egl-9 family hypoxia-inducible factor 2 (EC:1.14.11.29)
Orthology
K09592  
hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Pathways in cancer
Renal cell carcinoma
Class
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.2
AA seq 407 aa AA seqDB search
MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAG
SGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRK
WAEDGGDAPSPSKRPWARQENQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALD
YIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQI
AWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDN
PHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEV
KPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggacagcccgtgccagccgcagcccctaagtcaggctctccctcagttaccagggtct
tcgtcagagcccttggagcctgagcctggccgggccaggatgggagtggagagttacctg
ccctgtcccctgctcccctcctaccactgtccaggagtgcctagtgaggcctcggcaggg
agtgggacccccagagccacagccacctctaccactgccagccctcttcgggacggtttt
ggcgggcaggatggtggtgagctgcggccgctgcagagtgaaggcgctgcagcgctggtc
accaaggggtgccagcgattggcagcccagggcgcacggcctgaggcccccaaacggaaa
tgggccgaggatggtggggatgccccttcacccagcaaacggccctgggccaggcaagag
aaccaggaggcagagcgggagggtggcatgagctgcagctgcagcagtggcagtggtgag
gccagtgctgggctgatggaggaggcgctgccctctgcgcccgagcgcctggccctggac
tatatcgtgccctgcatgcggtactacggcatctgcgtcaaggacagcttcctgggggca
gcactgggcggtcgcgtgctggccgaggtggaggccctcaaacggggtgggcgcctgcga
gacgggcagctagtgagccagagggcgatcccgccgcgcagcatccgtggggaccagatt
gcctgggtggaaggccatgaaccaggctgtcgaagcattggtgccctcatggcccatgtg
gacgccgtcatccgccactgcgcagggcggctgggcagctatgtcatcaacgggcgcacc
aaggccatggtggcgtgttacccaggcaacgggctcgggtacgtaaggcacgttgacaat
ccccacggcgatgggcgctgcatcacctgtatctattacctgaatcagaactgggacgtt
aaggtgcatggcggcctgctgcagatcttccctgagggccggcccgtggtagccaacatc
gagccactctttgaccggttgctcattttctggtctgaccggcggaacccccacgaggtg
aagccagcctatgccaccaggtacgccatcactgtctggtattttgatgccaaggagcgg
gcagcagccaaagacaagtatcagctagcatcaggacagaaaggtgtccaagtacctgta
tcacagccgcctacgcccacctag

DBGET integrated database retrieval system