KEGG   Homo sapiens (human): 112399Help
Entry
112399            CDS       T01001                                 

Gene name
EGLN3, HIFP4H3, HIFPH3, PHD3
Definition
egl-9 family hypoxia-inducible factor 3 (EC:1.14.11.29)
Orthology
K09592  
hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Pathways in cancer
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    112399 (EGLN3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    112399 (EGLN3)
   05211 Renal cell carcinoma
    112399 (EGLN3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     112399 (EGLN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q13.1
AA seq 239 aa AA seqDB search
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQ
LAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKA
MVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEP
IFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgggacacatcatgaggctggacctggagaaaattgccctggagtacatcgtg
ccctgtctgcacgaggtgggcttctgctacctggacaacttcctgggcgaggtggtgggc
gactgcgtcctggagcgcgtcaagcagctgcactgcaccggggccctgcgggacggccag
ctggcggggccgcgcgccggcgtctccaagcgacacctgcggggcgaccagatcacgtgg
atcgggggcaacgaggagggctgcgaggccatcagcttcctcctgtccctcatcgacagg
ctggtcctctactgcgggagccggctgggcaaatactacgtcaaggagaggtctaaggca
atggtggcttgctatccgggaaatggaacaggttatgttcgccacgtggacaaccccaac
ggtgatggtcgctgcatcacctgcatctactatctgaacaagaattgggatgccaagcta
catggtgggatcctgcggatatttccagaggggaaatcattcatagcagatgtggagccc
atttttgacagactcctgttcttctggtcagatcgtaggaacccacacgaagtgcagccc
tcttacgcaaccagatatgctatgactgtctggtactttgatgctgaagaaagggcagaa
gccaaaaagaaattcaggaatttaactaggaaaactgaatctgccctcactgaagactga

DBGET integrated database retrieval system