KEGG   Homo sapiens (human): 112401Help
Entry
112401            CDS       T01001                                 

Gene name
BIRC8, ILP-2, ILP2, hILP2
Definition
baculoviral IAP repeat containing 8
Orthology
K16061  
baculoviral IAP repeat-containing protein 7/8
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Toxoplasmosis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112401 (BIRC8)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    112401 (BIRC8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    112401 (BIRC8)
   05222 Small cell lung cancer
    112401 (BIRC8)
  Infectious diseases
   05145 Toxoplasmosis
    112401 (BIRC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19
AA seq 236 aa AA seqDB search
MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHA
KWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIR
MGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPL
RRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgacgggttatgaagcccggctcattacttttgggacatggatgtactccgttaacaaa
gagcagcttgcaagagctggattttatgctataggtcaagaggataaagtacagtgcttt
cactgtggaggagggctagccaactggaagcccaaggaagatccttgggaacagcatgct
aaatggtatccaggttgcaaatatctgctagaagagaagggacatgaatatataaacaac
attcatttaacccgttcacttgagggagctctggtacaaactaccaagaaaacaccatca
ctaactaaaagaatcagtgataccatcttccctaatcctatgctacaagaagctatacga
atgggatttgatttcaaggacgttaagaaaataatggaggaaagaattcaaacatctggg
agcaactataaaacgcttgaggttcttgttgcagatctagtgagcgctcagaaagacact
acagaaaatgaattgaatcagacttcattgcagagagaaatcagccctgaagagccgcta
aggcgtctgcaagaggagaagctttgtaaaatctgcatggacagacatatcgctgttgtt
tttattccttgtggacatctggtcacttgtaaacaatgtgctgaagcagttgacagatgt
cccatgtgcagcgcggttattgatttcaagcaaagagtttttatgtcttaa

DBGET integrated database retrieval system