KEGG   Homo sapiens (human): 112401Help
Entry
112401            CDS       T01001                                 

Gene name
BIRC8, ILP-2, ILP2, hILP2
Definition
baculoviral IAP repeat containing 8
Orthology
K16061  
baculoviral IAP repeat-containing protein 7/8
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Toxoplasmosis
Pathways in cancer
Small cell lung cancer
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19
AA seq 236 aa AA seqDB search
MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHA
KWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIR
MGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPL
RRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgacgggttatgaagcccggctcattacttttgggacatggatgtactccgttaacaaa
gagcagcttgcaagagctggattttatgctataggtcaagaggataaagtacagtgcttt
cactgtggaggagggctagccaactggaagcccaaggaagatccttgggaacagcatgct
aaatggtatccaggttgcaaatatctgctagaagagaagggacatgaatatataaacaac
attcatttaacccgttcacttgagggagctctggtacaaactaccaagaaaacaccatca
ctaactaaaagaatcagtgataccatcttccctaatcctatgctacaagaagctatacga
atgggatttgatttcaaggacgttaagaaaataatggaggaaagaattcaaacatctggg
agcaactataaaacgcttgaggttcttgttgcagatctagtgagcgctcagaaagacact
acagaaaatgaattgaatcagacttcattgcagagagaaatcagccctgaagagccgcta
aggcgtctgcaagaggagaagctttgtaaaatctgcatggacagacatatcgctgttgtt
tttattccttgtggacatctggtcacttgtaaacaatgtgctgaagcagttgacagatgt
cccatgtgcagcgcggttattgatttcaagcaaagagtttttatgtcttaa

DBGET integrated database retrieval system