KEGG   Homo sapiens (human): 112401Help
Entry
112401            CDS       T01001                                 

Gene name
BIRC8, ILP-2, ILP2, hILP2
Definition
(RefSeq) baculoviral IAP repeat containing 8
  KO
K16061  
baculoviral IAP repeat-containing protein 7/8
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Apoptosis - multiple species
Toxoplasmosis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112401 (BIRC8)
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    112401 (BIRC8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    112401 (BIRC8)
   05222 Small cell lung cancer
    112401 (BIRC8)
  Infectious diseases
   05145 Toxoplasmosis
    112401 (BIRC8)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    112401 (BIRC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.42
AA seq 236 aa AA seqDB search
MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHA
KWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIR
MGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPL
RRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgacgggttatgaagcccggctcattacttttgggacatggatgtactccgttaacaaa
gagcagcttgcaagagctggattttatgctataggtcaagaggataaagtacagtgcttt
cactgtggaggagggctagccaactggaagcccaaggaagatccttgggaacagcatgct
aaatggtatccaggttgcaaatatctgctagaagagaagggacatgaatatataaacaac
attcatttaacccgttcacttgagggagctctggtacaaactaccaagaaaacaccatca
ctaactaaaagaatcagtgataccatcttccctaatcctatgctacaagaagctatacga
atgggatttgatttcaaggacgttaagaaaataatggaggaaagaattcaaacatctggg
agcaactataaaacgcttgaggttcttgttgcagatctagtgagcgctcagaaagacact
acagaaaatgaattgaatcagacttcattgcagagagaaatcagccctgaagagccgcta
aggcgtctgcaagaggagaagctttgtaaaatctgcatggacagacatatcgctgttgtt
tttattccttgtggacatctggtcacttgtaaacaatgtgctgaagcagttgacagatgt
cccatgtgcagcgcggttattgatttcaagcaaagagtttttatgtcttaa

DBGET integrated database retrieval system