KEGG   Homo sapiens (human): 112483Help
Entry
112483            CDS       T01001                                 

Gene name
SAT2, SSAT2
Definition
spermidine/spermine N1-acetyltransferase family member 2 (EC:2.3.1.57)
Orthology
K00657  
diamine N-acetyltransferase [EC:2.3.1.57]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.1
AA seq 170 aa AA seqDB search
MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEIL
PAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDK
GCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgtgcggatccgagaggccaaggagggagactgtggagatatcctgaggctg
attcgggagctagccgaattcgaaaaactctcggatcaggtgaagatcagtgaagaagcc
ctgagagcagatggctttggagacaatcctttctatcactgtttggtagcagagattctt
ccagcgcccgggaagctactggggccctgcgtggtgggctatgggatatactatttcatc
tacagtacatggaagggacgcaccatttatctggaggatatctatgtgatgccggaatat
cggggtcaagggattggttccaaaataatcaaaaaggtggctgaggtggccttggataag
ggctgctcccaattccgcctggccgtcctggactggaaccagagggccatggacttgtac
aaggccctaggagcccaagatctgacggaagctgagggctggcacttcttctgctttcaa
ggagaggcaacgagaaagttggcaggaaagtga

DBGET integrated database retrieval system