KEGG   Homo sapiens (human): 11251Help
Entry
11251             CDS       T01001                                 

Gene name
PTGDR2, CD294, CRTH2, DL1R, DP2, GPR44
Definition
(RefSeq) prostaglandin D2 receptor 2
  KO
K06715  
G protein-coupled receptor 44
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   Chemokine like
    11251 (PTGDR2)
Cellular antigens [BR:hsa04090]
 Proteins
  11251 (PTGDR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.2
AA seq 395 aa AA seqDB search
MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccaacgccacactgaagccactctgccccatcctggagcagatgagccgtctc
cagagccacagcaacaccagcatccgctacatcgaccacgcggccgtgctgctgcacggg
ctggcctcgctgctgggcctggtggagaatggagtcatcctcttcgtggtgggctgccgc
atgcgccagaccgtggtcaccacctgggtgctgcacctggcgctgtccgacctgttggcc
tctgcttccctgcccttcttcacctacttcttggccgtgggccactcgtgggagctgggc
accaccttctgcaaactgcactcctccatcttctttctcaacatgttcgccagcggcttc
ctgctcagcgccatcagcctggaccgctgcctgcaggtggtgcggccggtgtgggcgcag
aaccaccgcaccgtggccgcggcgcacaaagtctgcctggtgctttgggcactagcggtg
ctcaacacggtgccctatttcgtgttccgggacaccatctcgcggctggacgggcgcatt
atgtgctactacaatgtgctgctcctgaacccggggcctgaccgcgatgccacgtgcaac
tcgcggcaggtggccctggccgtcagcaagttcctgctggccttcctggtgccgctggcg
atcatcgcctcgagccacgcggccgtgagcctgcggttgcagcaccgcggccgccggcgg
ccaggccgcttcgtgcgcctggtggcggccgtcgtggccgccttcgcgctctgctggggg
ccctaccacgtgttcagcctgctggaggcgcgggcgcacgcaaacccggggctgcggccg
ctcgtgtggcgcgggctgcccttcgtcaccagcctggccttcttcaacagcgtggccaac
ccggtgctctacgtgctcacctgccccgacatgctgcgcaagctgcggcgctcgctgcgc
acggtgctggagagcgtgctggtggacgacagcgagctgggtggcgcgggaagcagccgc
cgccgccgcacctcctccaccgcccgctcggcctcccctttagctctctgcagccgcccg
gaggaaccgcggggccccgcgcgtctcctcggctggctgctgggcagctgcgcagcgtcc
ccgcagacgggccccctgaaccgggcgctgagcagcacctcgagttag

DBGET integrated database retrieval system