KEGG   Homo sapiens (human): 11252Help
Entry
11252             CDS       T01001                                 

Gene name
PACSIN2, SDPII
Definition
(RefSeq) protein kinase C and casein kinase substrate in neurons 2
  KO
K20123  
protein kinase C and casein kinase substrate in neurons protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.2-q13.33
AA seq 486 aa AA seqDB search
MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLT
EWARRWRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNWQKEAF
HKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKADP
SLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKR
LRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQ
FEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSS
YNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFD
DDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPAN
YVEAIQ
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcacatatgatgattccgttggagtagaagtgtccagcgacagcttctgggag
gtcgggaactacaagcggactgtgaagcggatcgacgatggccaccgcctgtgcagcgac
ctcatgaactgcctgcatgagcgggcgcgcatcgagaaggcgtatgcgcagcagctcact
gagtgggcccggcgctggaggcagctcgtggagaaagggccccagtacgggaccgtggag
aaggcctggatggccttcatgtccgaggcagagagggtgagcgagctgcacctcgaggtg
aaggcctcactgatgaacgatgacttcgagaagatcaagaactggcagaaggaagccttt
cacaagcagatgatgggcggcttcaaggagaccaaggaagctgaggacggctttcggaag
gcacagaagccctgggccaagaagctgaaagaggtagaagcagcaaagaaagcccaccat
gcagcgtgcaaagaggagaagctggctatctcacgagaagccaacagcaaggcagaccca
tccctcaaccctgaacagctcaagaaattgcaagacaaaatagaaaagtgcaagcaagat
gttcttaagaccaaagagaagtatgagaagtccctgaaggaactcgaccagggcacaccc
cagtacatggagaacatggagcaggtgtttgagcagtgccagcagttcgaggagaaacgc
cttcgcttcttccgggaggttctgctggaggttcagaagcacctagacctgtccaatgtg
gctggctacaaagccatttaccatgacctggagcagagcatcagagcagctgatgcagtg
gaggacctgaggtggttccgagccaatcacgggccgggcatggccatgaactggccgcag
tttgaggagtggtccgcagacctgaatcgaaccctcagccggagagagaagaagaaggcc
actgacggcgtcaccctgacgggcatcaaccagacaggcgaccagtctctgccgagtaag
cccagcagcacccttaatgtcccgagcaaccccgcccagtctgcgcagtcacagtccagc
tacaaccccttcgaggatgaggacgacacgggcagcaccgtcagtgagaaggacgacact
aaggccaaaaatgtgagcagctacgagaagacccagagctatcccaccgactggtcagac
gatgagtctaacaaccccttctcctccacggatgccaatggggactcgaatccattcgac
gacgacgccacctcggggacggaagtgcgagtccgggccctgtatgactatgaggggcag
gagcatgatgagctgagcttcaaggctggggatgagctgaccaagatggaggacgaggat
gagcagggctggtgcaagggacgcttggacaacgggcaagttggcctatacccggcaaat
tatgtggaggcgatccagtga

DBGET integrated database retrieval system