KEGG   Homo sapiens (human): 11255Help
Entry
11255             CDS       T01001                                 

Gene name
HRH3, GPCR97, HH3R
Definition
(RefSeq) histamine receptor H3
  KO
K04151  
histamine receptor H3
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Betahistine (DG01004): 
Cipralisant maleate: 
Histamine: 
Irdabisant (DG01330): 
Pitolisant: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11255 (HRH3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Histamine [OT]
    11255 (HRH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.33
AA seq 445 aa AA seqDB search
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
RAFTKLLCPQKLKIQPHSSLEHCWK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcgccgcccgacgggccgctgaacgcttcgggggcgctggcgggcgaggcg
gcggcggcgggcggggcgcgcggcttctcggcagcctggaccgcggtgctggccgcgctc
atggcgctgctcatcgtggccacggtgctgggcaacgcgctggtcatgctcgccttcgtg
gccgactcgagcctccgcacccagaacaacttcttcctgctcaacctcgccatctccgac
ttcctcgtcggcgccttctgcatcccactgtatgtaccctacgtgctgacaggccgctgg
accttcggccggggcctctgcaagctgtggctggtagtggactacctgctgtgcacctcc
tctgccttcaacatcgtgctcatcagctacgaccgcttcctgtcggtcacccgagcggtc
tcataccgggcccagcagggtgacacgcggcgggcagtgcggaagatgctgctggtgtgg
gtgctggccttcctgctgtacggaccagccatcctgagctgggagtacctgtccgggggc
agctccatccccgagggccactgctatgccgagttcttctacaactggtacttcctcatc
acggcttccaccctggagttctttacgcccttcctcagcgtcaccttctttaacctcagc
atctacctgaacatccagaggcgcacccgcctccggctggatggggctcgagaggcagcc
ggccccgagccccctcccgaggcccagccctcaccacccccaccgcctggctgctggggc
tgctggcagaaggggcacggggaggccatgccgctgcacaggtatggggtgggtgaggcg
gccgtaggcgctgaggccggggaggcgaccctcgggggtggcggtgggggcggctccgtg
gcttcacccacctccagctccggcagctcctcgaggggcactgagaggccgcgctcactc
aagaggggctccaagccgtcggcgtcctcggcctcgctggagaagcgcatgaagatggtg
tcccagagcttcacccagcgctttcggctgtctcgggacaggaaagtggccaagtcgctg
gccgtcatcgtgagcatctttgggctctgctgggccccatacacgctgctgatgatcatc
cgggccgcctgccatggccactgcgtccctgactactggtacgaaacctccttctggctc
ctgtgggccaactcggctgtcaaccctgtcctctaccctctgtgccaccacagcttccgc
cgggccttcaccaagctgctctgcccccagaagctcaaaatccagccccacagctccctg
gagcactgctggaagtga

DBGET integrated database retrieval system