KEGG   Homo sapiens (human): 11261Help
Entry
11261             CDS       T01001                                 

Gene name
CHP1, CHP, SLC9A1BP, Sid470p, p22, p24
Definition
calcineurin-like EF-hand protein 1
Orthology
K17610  
calcineurin B homologous protein 1
Organism
hsa  Homo sapiens (human)
Drug target
Tacrolimus: 
Pimecrolimus: 
Ciclosporin: 
Tacrolimus: 
Voclosporin: 
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q13.3
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcgggcctccacgttactgcgggacgaagagctcgaggagatcaagaaggag
accggcttttcccacagtcaaatcactcgcctctacagccggttcaccagcctggacaaa
ggagagaatgggactctcagccgggaagatttccagaggattccagaacttgccatcaac
ccactgggggaccggatcatcaatgccttctttccagagggagaggaccaggtaaacttc
cgtggattcatgcgaactttggctcatttccgccccattgaggataatgaaaagagcaaa
gatgtgaatggacccgaaccactcaacagccgaagcaacaaactgcactttgcttttcga
ctatatgatttggataaagatgaaaagatctcccgtgatgagctgttacaggtgctacgc
atgatggtcggagtaaatatctcagatgagcagctgggcagcatcgcagacaggaccatt
caggaggctgatcaggatggggacagtgccatatctttcacagaatttgttaaggttttg
gagaaggtggatgtagaacagaaaatgagcatccgatttcttcactaa

DBGET integrated database retrieval system