KEGG   Homo sapiens (human): 112714Help
Entry
112714            CDS       T01001                                 

Gene name
TUBA3E
Definition
tubulin, alpha 3e
Orthology
K07374  
tubulin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    112714 (TUBA3E)
  Cellular commiunity
   04540 Gap junction
    112714 (TUBA3E)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    112714 (TUBA3E)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112714 (TUBA3E)
  Exosomal proteins of other body fluids (saliva and urine)
   112714 (TUBA3E)
  Exosomal proteins of colorectal cancer cells
   112714 (TUBA3E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q21.1
AA seq 450 aa AA seqDB search
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAASNYARGHYTIGKEIVDLVLD
RIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYSKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLVHKFDLMYAKWAFVHWYVGEGMEEGEFSE
AREDLAALEKDCEEVGVDSVEAEAEEGEEY
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagtgtatctctatccacgtggggcaggcgggtgtccagatcggcaatgcctgc
tgggaactgtactgccttgaacatggaattcagcccgatggtcaaatgccaagtgataaa
accattggtggcggggacgactccttcaacacgttcttcagtgagactggagctggcaag
cacgtgcccagagcagtgtttgtggacctggagcccactgtggtcgatgaagtgcgcaca
gggacctacaggcagctcttccacccagagcagctgatcaccgggaaggaagatgcagcc
agtaattacgccaggggccattacaccatcggcaaggagattgttgacctagtcctggac
cggatccgcaaactggcggatctgtgcacaggactgcagggcttcctcatcttccacagc
tttgggggcggcactggctctgggttcgcatctctgctcatggagcggctctcagtggat
tacagcaagaagtccaagctagagtttgccatttacccagccccccaggtctccacagcc
gtggtggagccctacaactccatcctaaccacccacacgaccctggaacattctgactgt
gccttcatggtcgacaatgaagccatctatgacatatgtcggcgcaacctggacattgaa
cgtcccacgtacaccaacctcaatcgcctgattgggcagatcgtgtcctccatcacggcc
tccctgcgatttgatggggccctgaatgtggacttgacggaattccagaccaacctcgtg
ccgtacccccgcatccacttccccctggccacctacgccccagtcatctcagctgagaag
gcctaccacgagcagctgtctgtggccgagatcaccaatgcctgcttcgagccagccaat
cagatggtcaagtgtgaccctcgccatggcaagtacatggcctgctgcatgttgtacagg
ggggacgtggtccccaaagacgtcaatgcggccatcgccaccatcaagaccaagcgcact
atccagtttgtggattggtgcccgactggatttaaggtgggcattaactaccagcccccc
acagtggtccccgggggagacctggccaaggtgcagcgggccgtgtgcatgctgagcaac
accacggccattgcggaggcctgggcccgcctggtccataagttcgatctcatgtatgcc
aagtgggcctttgtgcactggtacgtgggcgaaggcatggaagagggagagttctctgag
gcccgcgaggacctggcagctctagagaaggattgtgaagaggtgggcgtggattccgtg
gaagctgaggctgaagaaggcgaagaatactga

DBGET integrated database retrieval system