KEGG   Homo sapiens (human): 11274Help
Entry
11274             CDS       T01001                                 

Gene name
USP18, ISG43, PTORCH2, UBP43
Definition
(RefSeq) ubiquitin specific peptidase 18
  KO
K11846  ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     11274 (USP18)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   11274 (USP18)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    11274 (USP18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 TAFII55_N NOB1_Zn_bind
Motif
Other DBs
NCBI-GeneID: 11274
NCBI-ProteinID: NP_059110
OMIM: 607057
HGNC: 12616
Ensembl: ENSG00000184979
Vega: OTTHUMG00000150104
Pharos: Q9UMW8(Tbio)
UniProt: Q9UMW8
Position
22q11.21
AA seq 372 aa AA seqDB search
MSKAFGLLRQICQSILAESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNI
GQTCCLNSLIQVFVMNVDFTRILKRITVPRGADEQRRSVPFQMLLLLEKMQDSRQKAVRP
LELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVHLVERLQALYTIRVKDSLICVD
CAMESSRNSSMLTLPLSLFDVDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGK
QVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGG
QYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWQE
TAYLLVYMKMEC
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcgtttgggctcctgaggcaaatctgtcagtccatcctggctgagtcctcg
cagtccccggcagatcttgaagaaaagaaggaagaagacagcaacatgaagagagagcag
cccagagagcgtcccagggcctgggactaccctcatggcctggttggtttacacaacatt
ggacagacctgctgccttaactccttgattcaggtgttcgtaatgaatgtggacttcacc
aggatattgaagaggatcacggtgcccaggggagctgacgagcagaggagaagcgtccct
ttccagatgcttctgctgctggagaagatgcaggacagccggcagaaagcagtgcggccc
ctggagctggcctactgcctgcagaagtgcaacgtgcccttgtttgtccaacatgatgct
gcccaactgtacctcaaactctggaacctgattaaggaccagatcactgatgtgcacttg
gtggagagactgcaggccctgtatacgatccgggtgaaggactccttgatttgcgttgac
tgtgccatggagagtagcagaaacagcagcatgctcaccctcccactttctctttttgat
gtggactcaaagcccctgaagacactggaggacgccctgcactgcttcttccagcccagg
gagttatcaagcaaaagcaagtgcttctgtgagaactgtgggaagaagacccgtgggaaa
caggtcttgaagctgacccatttgccccagaccctgacaatccacctcatgcgattctcc
atcaggaattcacagacgagaaagatctgccactccctgtacttcccccagagcttggat
ttcagccagatccttccaatgaagcgagagtcttgtgatgctgaggagcagtctggaggg
cagtatgagctttttgctgtgattgcgcacgtgggaatggcagactccggtcattactgt
gtctacatccggaatgctgtggatggaaaatggttctgcttcaatgactccaatatttgc
ttggtgtcctgggaagacatccagtgtacctacggaaatcctaactaccactggcaggaa
actgcatatcttctggtttacatgaagatggagtgctaa

DBGET integrated database retrieval system