KEGG   Homo sapiens (human): 11274Help
Entry
11274             CDS       T01001                                 

Gene name
USP18, ISG43, UBP43
Definition
(RefSeq) ubiquitin specific peptidase 18
  KO
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     11274 (USP18)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   11274 (USP18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.21
AA seq 372 aa AA seqDB search
MSKAFGLLRQICQSILAESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNI
GQTCCLNSLIQVFVMNVDFTRILKRITVPRGADEQRRSVPFQMLLLLEKMQDSRQKAVRP
LELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVHLVERLQALYTIRVKDSLICVD
CAMESSRNSSMLTLPLSLFDVDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGK
QVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGG
QYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWQE
TAYLLVYMKMEC
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcgtttgggctcctgaggcaaatctgtcagtccatcctggctgagtcctcg
cagtccccggcagatcttgaagaaaagaaggaagaagacagcaacatgaagagagagcag
cccagagagcgtcccagggcctgggactaccctcatggcctggttggtttacacaacatt
ggacagacctgctgccttaactccttgattcaggtgttcgtaatgaatgtggacttcacc
aggatattgaagaggatcacggtgcccaggggagctgacgagcagaggagaagcgtccct
ttccagatgcttctgctgctggagaagatgcaggacagccggcagaaagcagtgcggccc
ctggagctggcctactgcctgcagaagtgcaacgtgcccttgtttgtccaacatgatgct
gcccaactgtacctcaaactctggaacctgattaaggaccagatcactgatgtgcacttg
gtggagagactgcaggccctgtatacgatccgggtgaaggactccttgatttgcgttgac
tgtgccatggagagtagcagaaacagcagcatgctcaccctcccactttctctttttgat
gtggactcaaagcccctgaagacactggaggacgccctgcactgcttcttccagcccagg
gagttatcaagcaaaagcaagtgcttctgtgagaactgtgggaagaagacccgtgggaaa
caggtcttgaagctgacccatttgccccagaccctgacaatccacctcatgcgattctcc
atcaggaattcacagacgagaaagatctgccactccctgtacttcccccagagcttggat
ttcagccagatccttccaatgaagcgagagtcttgtgatgctgaggagcagtctggaggg
cagtatgagctttttgctgtgattgcgcacgtgggaatggcagactccggtcattactgt
gtctacatccggaatgctgtggatggaaaatggttctgcttcaatgactccaatatttgc
ttggtgtcctgggaagacatccagtgtacctacggaaatcctaactaccactggcaggaa
actgcatatcttctggtttacatgaagatggagtgctaa

DBGET integrated database retrieval system