KEGG   Homo sapiens (human): 112755Help
Entry
112755            CDS       T01001                                 

Gene name
STX1B, GEFSP9, STX1B1, STX1B2
Definition
(RefSeq) syntaxin 1B
  KO
K08486  syntaxin 1B/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04721  Synaptic vesicle cycle
Disease
H00783  Febrile seizures
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    112755 (STX1B)
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    112755 (STX1B)
Membrane trafficking [BR:hsa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    112755 (STX1B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   112755 (STX1B)
  Exosomal proteins of other body fluids (saliva and urine)
   112755 (STX1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin SNARE Syntaxin_2 AAA_13 GNVR Lzipper-MIP1 FAD_binding_1 DUF1910 Baculo_PEP_C RE_NgoFVII Acyl-CoA_dh_2 TolA_bind_tri Sec34
Motif
Other DBs
NCBI-GeneID: 112755
NCBI-ProteinID: NP_443106
OMIM: 601485
HGNC: 18539
Ensembl: ENSG00000099365
Vega: OTTHUMG00000132391
Pharos: P61266(Tbio)
UniProt: P61266
Position
16p11.2
AA seq 288 aa AA seqDB search
MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAI
LAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHS
TLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDI
KMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSV
DYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatcggactcaagagctgcggagtgcgaaagacagtgatgatgaagaggaggtg
gtccacgtggatcgggaccacttcatggatgagttctttgaacaggtggaagagatccgg
ggctgcattgagaaactgtcggaggatgtggagcaggtgaaaaaacagcatagcgccatc
ctggccgcacccaacccagatgagaagaccaaacaggagctggaggatctcactgcagac
atcaagaagacggccaacaaggttcggtccaaattgaaagcgatcgagcaaagcattgaa
caggaggaggggctgaaccgttcctccgcggacctgcgcatccgcaagacccagcactcc
acactgtcccggaagttcgtggaggtaatgaccgaatataacgcgacccagtccaagtac
cgggaccgctgcaaggaccggatccagcggcaactggagatcactggaaggaccaccacc
aacgaagaactggaagacatgctggagagcgggaagctggccatcttcacagatgacatc
aaaatggactcacagatgacgaagcaggcgctgaatgagattgagacgaggcacaatgag
atcatcaagctggagaccagcatccgcgagctgcacgatatgtttgtggacatggccatg
ctcgtagagagccagggagagatgattgaccgcatcgagtacaacgtggaacattctgtg
gactacgtggagcgagctgtgtctgacaccaagaaagcagtgaaatatcagagcaaggcc
cggaggaagaaaatcatgatcatcatttgctgtgtggtgctgggggtggtcttggcgtca
tccattggggggacgctgggcttgtag

DBGET integrated database retrieval system