KEGG   Homo sapiens (human): 112755Help
Entry
112755            CDS       T01001                                 

Gene name
STX1B, STX1B1, STX1B2
Definition
syntaxin 1B
Orthology
K08486  
syntaxin 1B/2/3
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Synaptic vesicle cycle
Class
Genetic Information Processing; Folding, sorting and degradation; SNARE interactions in vesicular transport [PATH:hsa04130]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 288 aa AA seqDB search
MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAI
LAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHS
TLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDI
KMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSV
DYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatcggactcaagagctgcggagtgcgaaagacagtgatgatgaagaggaggtg
gtccacgtggatcgggaccacttcatggatgagttctttgaacaggtggaagagatccgg
ggctgcattgagaaactgtcggaggatgtggagcaggtgaaaaaacagcatagcgccatc
ctggccgcacccaacccagatgagaagaccaaacaggagctggaggatctcactgcagac
atcaagaagacggccaacaaggttcggtccaaattgaaagcgatcgagcaaagcattgaa
caggaggaggggctgaaccgttcctccgcggacctgcgcatccgcaagacccagcactcc
acactgtcccggaagttcgtggaggtaatgaccgaatataacgcgacccagtccaagtac
cgggaccgctgcaaggaccggatccagcggcaactggagatcactggaaggaccaccacc
aacgaagaactggaagacatgctggagagcgggaagctggccatcttcacagatgacatc
aaaatggactcacagatgacgaagcaggcgctgaatgagattgagacgaggcacaatgag
atcatcaagctggagaccagcatccgcgagctgcacgatatgtttgtggacatggccatg
ctcgtagagagccagggagagatgattgaccgcatcgagtacaacgtggaacattctgtg
gactacgtggagcgagctgtgtctgacaccaagaaagcagtgaaatatcagagcaaggcc
cggaggaagaaaatcatgatcatcatttgctgtgtggtgctgggggtggtcttggcgtca
tccattggggggacgctgggcttgtag

DBGET integrated database retrieval system