KEGG   Homo sapiens (human): 11276Help
Entry
11276             CDS       T01001                                 

Gene name
SYNRG, AP1GBP1, SYNG
Definition
(RefSeq) synergin, gamma
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q12
AA seq 1314 aa AA seqDB search
MALRPGAGSGGGGAAGAGAGSAGGGGFMFPVAGGIRPPQAGLMPMQQQGFPMVSVMQPNM
QGIMGMNYSSQMSQGPIAMQAGIPMGPMPAAGMPYLGQAPFLGMRPPGPQYTPDMQKQFA
EEQQKRFEQQQKLLEEERKRRQFEEQKQKLRLLSSVKPKTGEKSRDDALEAIKGNLDGFS
RDAKMHPTPASHPKKPGPSLEEKFLVSCDISTSGQEQIKLNTSEVGHKALGPGSSKKYPS
LMASNGVAVDGCVSGTTTAEAENTSDQNLSIEESGVGVFPSQDPAQPRMPPWIYNESLVP
DAYKKILETTMTPTGIDTAKLYPILMSSGLPRETLGQIWALANRTTPGKLTKEELYTVLA
MIAVTQRGVPAMSPDALNQFPAAPIPTLSGFSMTLPTPVSQPTVIPSGPAGSMPLSLGQP
VMGINLVGPVGGAAAQASSGFIPTYPANQVVKPEEDDFQDFQDASKSGSLDDSFSDFQEL
PASSKTSNSQHGNSAPSLLMPLPGTKALPSMDKYAVFKGIAADKSSENTVPPGDPGDKYS
AFRELEQTAENKPLGESFAEFRSAGTDDGFTDFKTADSVSPLEPPTKDKTFPPSFPSGTI
QQKQQTQVKNPLNLADLDMFSSVNCSSEKPLSFSAVFSTSKSVSTPQSTGSAATMTALAA
TKTSSLADDFGEFSLFGEYSGLAPVGEQDDFADFMAFSNSSISSEQKPDDKYDALKEEAS
PVPLTSNVGSTVKGGQNSTAASTKYDVFRQLSLEGSGLGVEDLKDNTPSGKSDDDFADFH
SSKFSSINSDKSLGEKAVAFRHTKEDSASVKSLDLPSIGGSSVGKEDSEDALSVQFDMKL
ADVGGDLKHVMSDSSLDLPTVSGQHPPAADIEDLKYAAFGSYSSNFAVSTLTSYDWSDRD
DATQGRKLSPFVLSAGSGSPSATSILQKKETSFGSSENITMTSLSKVTTFVSEDALPETT
FPALASFKDTIPQTSEQKEYENRDYKDFTKQDLPTAERSQEATCPSPASSGASQETPNEC
SDDFGEFQSEKPKISKFDFLVATSQSKMKSSEEMIKSELATFDLSVQGSHKRSLSLGDKE
ISRSSPSPALEQPFRDRSNTLNEKPALPVIRDKYKDLTGEVEENERYAYEWQRCLGSALN
VIKKANDTLNGISSSSVCTEVIQSAQGMEYLLGVVEVYRVTKRVELGIKATAVCSEKLQQ
LLKDIDKVWNNLIGFMSLATLTPDENSLDFSSCMLRPGIKNAQELACGVCLLNVDSRSRK
EEKPAEEHPKKAFNSETDSFKLAYGGHQYHASCANFWINCVEPKPPGLVLPDLL
NT seq 3945 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcggccaggagctggttctggtggcggcggggccgcgggagctggcgcgggg
tccgccgggggaggcggcttcatgtttcctgttgcaggtgggataagaccccctcaagca
ggcctgatgccgatgcagcaacaaggatttcctatggtctctgtcatgcagcctaatatg
caaggcattatgggaatgaattacagctctcagatgtcccaaggacctattgctatgcag
gcaggaataccaatgggaccaatgccagcagcgggaatgccttacctaggacaagcaccc
ttcctgggcatgcgtcctccaggcccacagtacactccagacatgcagaagcagtttgcc
gaagagcagcagaaacgatttgaacagcagcaaaaactcttagaagaagaaagaaaaaga
cgccagtttgaagagcagaagcaaaagctcagacttttgagcagtgtgaaacccaagaca
ggagagaagagtagagatgatgctttggaagccataaaaggaaatttagatgggttttcc
agagatgcaaaaatgcaccctactccagcatcgcaccccaagaaaccaggcccttccttg
gaggagaagttcctagtatcttgtgatataagtacatctgggcaggaacaaattaaatta
aatacttctgaagttggccacaaagccctaggcccaggttccagtaagaagtatcccagt
ttaatggccagtaacggggttgctgtagatggatgtgtaagtggtaccaccactgcagag
gcagaaaatacttcagatcaaaacctgtcaattgaagagagtggtgtgggagtatttccc
tcacaggatcctgctcagcccagaatgcctccttggatttacaatgagagtttggttcca
gatgcctataagaaaatcttagaaaccacaatgactccaactggaatagatactgccaaa
ctgtatcccattctgatgtcatctgggcttcccagggaaactcttggacagatatgggcc
ttagctaatcgaactacacctggcaaacttacaaaagaagaactttataccgttctagcc
atgatagcggtaacacagaggggcgttcctgcaatgagtcctgatgctttaaaccagttc
ccagcagctcctattccaactttaagtggcttttctatgactctgcctacaccggtgagt
cagccaactgtgataccttcaggtcctgcgggctccatgcccctcagccttggacagcca
gtcatgggcattaaccttgttggaccagtgggtggagctgcagcccaggcttctagtggt
ttcataccaacctaccctgcaaatcaggtagtaaagccagaagaagatgacttccaggat
tttcaagatgcttctaagtcaggatcccttgatgactcattcagtgatttccaagagttg
cctgcttcttcaaaaacaagtaactcccagcatggaaacagtgccccttctttgttgatg
ccacttcctggaactaaagcattgccttcaatggacaaatatgctgtgtttaaaggaatt
gcagctgacaagtcctctgaaaatactgttccacctggagatcctggtgataaatatagt
gctttcagagaacttgaacagacagcagagaataaacctttaggagaaagctttgcagaa
ttcagatctgcaggaactgatgatggtttcaccgattttaaaacagccgatagtgtatca
ccactagagccaccaacaaaagacaaaacttttccaccatccttcccctcaggaactata
caacagaaacaacaaacacaagtgaaaaaccctctgaacttagcagacctagatatgttt
tcctcagttaattgcagcagcgagaaaccattgtctttttcagctgtgtttagcacatca
aaatcagtttctacaccacagtcaacaggttctgctgctactatgacagcattggcagca
acaaaaacttctagtttggctgatgattttggagaattcagcctttttggggaatattct
ggtctagcacctgttggggagcaggatgactttgcagattttatggctttcagtaatagc
tctatttcatctgagcaaaagccggatgacaaatatgatgcccttaaagaggaagccagt
cctgttcctctaaccagcaacgtgggcagcacagtgaagggtggacaaaactcgactgct
gcgtctaccaagtacgatgtcttcagacaactttctctggaagggtctggactaggtgtt
gaagacctgaaagataacactccttcaggaaaaagtgatgatgattttgctgacttccac
tccagtaaattttcttccataaactcggacaaatccctgggagagaaagcagtggctttc
agacacaccaaagaagactctgcatcagtgaagtccttagatctcccttccattggtggc
agcagtgttggcaaggaggactctgaagatgcactctctgttcagtttgacatgaaattg
gctgatgtgggaggagatcttaagcatgtcatgtctgatagctctttggatttaccaaca
gttagtggccagcatcctcctgctgcagatatagaggacttaaaatatgctgcttttgga
agctacagtagcaattttgcagtgagcacacttacaagctatgactggtcagacagggat
gatgcaactcagggcagaaaactctctccatttgtcctctcagcaggaagtggatccccc
tcagccacctcaattcttcaaaagaaagagacttcatttggcagttctgaaaacatcacc
atgacatctctctccaaagtaacgacctttgtaagtgaagatgctcttccagagaccacc
ttcccagctcttgccagttttaaagacacgattcctcagaccagtgagcaaaaggaatat
gaaaacagagactataaagatttcacaaaacaggacctgcctacggctgaacggagccag
gaggccacgtgtcccagcccagcgtccagtggtgcctctcaagaaaccccgaacgaatgt
tcggatgactttggagagtttcaaagtgaaaagcccaaaatcagcaaatttgacttctta
gtagccacttcacaaagcaaaatgaaatccagtgaagaaatgatcaaaagtgagctggca
acctttgacctttctgttcaaggatcacacaagaggagtttgagccttggtgataaagaa
ataagccgttcttctccttctccagctttggagcagcctttcagagaccgttccaatact
ctgaatgagaagcccgccctgcccgtcatccgagacaagtacaaagacctgacgggagag
gtggaggaaaatgagagatatgcatatgaatggcagagatgcctggggagtgccctgaat
gtcattaagaaggcaaatgataccttaaatggaatcagtagtagttctgtttgcacagaa
gtaattcagtcagctcaaggcatggaatatttattaggtgttgttgaagtgtacagggta
accaagcgtgtggagctggggataaaagccactgcagtgtgcagtgagaaactccagcag
ttgctgaaggacatcgataaagtatggaataacctaatcggcttcatgtcactcgccaca
ctcacaccagatgaaaactcgctggatttttcctcctgtatgttacggcctgggattaaa
aatgctcaggagcttgcctgtggagtgtgcctcttgaatgtggactcgaggagccggaaa
gaagagaagcctgcagaagaacatcctaaaaaagcattcaactcagaaacagacagtttc
aagctggcctatggagggcaccagtatcacgccagctgtgccaacttctggatcaactgt
gtcgaaccaaagcctcctggcctcgtcctgcctgacctgctctga

DBGET integrated database retrieval system