KEGG   Homo sapiens (human): 11277Help
Entry
11277             CDS       T01001                                 

Gene name
TREX1, AGS1, CRV, DRN3, HERNS
Definition
(RefSeq) three prime repair exonuclease 1 (EC:3.1.11.2)
  KO
K10790  
three prime repair exonuclease 1 [EC:3.1.11.2]
Organism
hsa  Homo sapiens (human)
Pathway
Cytosolic DNA-sensing pathway
Disease
H00290  
Aicardi-Goutieres Syndrome (AGS)
H00291  
Familial chilblain lupus (FCL)
H01000  
Retinal vasculopathy with cerebral leukodystrophy (RVCL)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04623 Cytosolic DNA-sensing pathway
    11277 (TREX1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     11277 (TREX1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Nucleases
    11277 (TREX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.31
AA seq 369 aa AA seqDB search
MGPGARRQGRIVQGRPEMCFCPPPTPLPPLRILTLGTHTPTPCSSPGSAAGTYPTMGSQA
LPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALESPPTSQGPPPTVPPPPRVVD
KLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHN
GDRYDFPLLQAELAMLGLTSALDGAFCVDSITALKALERASSPSEHGPRKSYSLGSIYTR
LYGQSPPDSHTAEGDVLALLSICQWRPQALLRWVDAHARPFGTIRPMYGVTASARTKPRP
SAVTTTAHLATTRNTSPSLGESRGTKDLPPVKDPGALSREGLLAPLGLLAILTLAVATLY
GLSLATPGE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgggccctggagctcgcagacagggcaggattgtgcagggaaggcctgagatgtgcttc
tgcccaccccctaccccactccctccccttcggatcttaacactgggcactcacacaccc
accccatgctcctctccaggctcagcagcaggtacgtacccaaccatgggctcgcaggcc
ctgcccccggggcccatgcagaccctcatctttttcgacatggaggccactggcttgccc
ttctcccagcccaaggtcacggagctgtgcctgctggctgtccacagatgtgccctggag
agcccccccacctctcaggggccacctcccacagttcctccaccaccgcgtgtggtagac
aagctctccctgtgtgtggctccggggaaggcctgcagccctgcagccagcgagatcaca
ggtctgagcacagctgtgctggcagcgcatgggcgtcaatgttttgatgacaacctggcc
aacctgctcctagccttcctgcggcgccagccacagccctggtgcctggtggcacacaat
ggtgaccgctacgacttccccctgctccaagcagagctggctatgctgggcctcaccagt
gctctggatggtgccttctgtgtggatagcatcactgcgctgaaggccctggagcgagca
agcagcccctcagaacacggcccaaggaagagctatagcctaggcagcatctacactcgc
ctgtatgggcagtcccctccagactcgcacacggctgagggtgatgtcctggccctgctc
agcatctgtcagtggagaccacaggccctgctgcggtgggtggatgctcacgccaggcct
ttcggcaccatcaggcccatgtatggggtcacagcctctgctaggaccaagccaagacca
tctgctgtcacaaccactgcacacctggccacaaccaggaacactagtcccagccttgga
gagagcaggggtaccaaggatcttcctccagtgaaggaccctggagccctatccagggag
gggctgctggccccactgggtctgctggccatcctgaccttggcagtagccacactgtat
ggactatccctggccacacctggggagtag

DBGET integrated database retrieval system