KEGG   Homo sapiens (human): 1128Help
Entry
1128              CDS       T01001                                 

Gene name
CHRM1, HM1, M1, M1R
Definition
(RefSeq) cholinergic receptor muscarinic 1
  KO
K04129  
muscarinic acetylcholine receptor M1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Cholinergic synapse
Regulation of actin cytoskeleton
Drug target
Aceclidine: 
Acetylcholine (DG01133): 
Aclatonium (DG01291): 
Aclidinium bromide: 
Acotiamide hydrochloride: 
Alvameline maleate: 
Anisotropine methylbromide: 
Atropine (DG00052): 
Atropine oxide (DG01243): 
Batefenterol (DG01627): 
Benzatropine (DG00859): 
Benzetimide (DG01301): 
Bethanechol (DG00991): 
Biperiden (DG00852): 
Butropium bromide: 
Butylscopolamine: 
Carbachol: 
Carpronium (DG01289): 
Cevimeline (DG00993): 
Chlorpromazine (DG00867): 
Choline alfoscerate: 
Cimetropium bromide: 
Clidinium bromide: 
Cyclopentolate (DG01141): 
Darotropium bromide: 
Dexetimide (DG00856): 
Dicycloverine (DG00032): 
Dihexyverine (DG00033): 
Diphenylpiperidinomethyldioxolan iodide: 
Diponium bromide: 
Esoxybutynin chloride: 
Etomidoline: 
Etybenzatropine: 
Eucatropine hydrochloride: 
Fentonium: 
Fesoterodine (DG00483): 
Flutropium bromide: 
Hexocyclium (DG00039): 
Homatropine (DG01142): 
Hyoscine methobromide: 
Hyoscyamine (DG00053): 
Imidafenacin: 
Ipratropium bromide: 
Isopropamide (DG00038): 
Mazaticol (DG00857): 
Mebeverine (DG00030): 
Mepenzolate (DG00040): 
Methacholine (DG01290): 
Methantheline (DG00036): 
Methylatropine (DG01242): 
Methylbenactyzium bromide: 
Methylscopolamine: 
Metixene (DG00853): 
Milameline hydrochloride: 
Orphenadrine (DG01252): 
Orphenadrine (chloride): 
Orphenadrine (citrate): 
Oxapium iodide: 
Oxitropium bromide: 
Oxybutynin (DG00478): 
Pilocarpine (DG00992): 
Piperidolate (DG00034): 
Pipethanate (DG01255): 
Pipethanate ethobromide: 
Pirenzepine (DG00026): 
Piroheptine (DG01272): 
Prifinium bromide: 
Procyclidine (DG00854): 
Profenamine (DG00855): 
Propantheline (DG00035): 
Propiverine (DG00479): 
Sabcomeline hydrochloride: 
Scopolamine (DG00065): 
Talsaclidine fumarate: 
Tazomeline citrate: 
Temiverine hydrochloride hydrate: 
Tiemonium (DG01254): 
Tiemonium iodide: 
Timepidium bromide (DG00041): 
Triampyzine sulfate: 
Tridihexethyl (DG00037): 
Trihexyphenidyl (DG00851): 
Trimebutine (DG00031): 
Tropicamide: 
Trospium: 
Umeclidinium (DG01253): 
Umeclidinium bromide: 
Valethamate: 
Xanomeline (DG01300): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    1128 (CHRM1)
   04024 cAMP signaling pathway
    1128 (CHRM1)
   04151 PI3K-Akt signaling pathway
    1128 (CHRM1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1128 (CHRM1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    1128 (CHRM1)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    1128 (CHRM1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    1128 (CHRM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13
AA seq 460 aa AA seqDB search
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacacttcagccccacctgctgtcagccccaacatcaccgtcctggcaccaggaaag
ggtccctggcaagtggccttcattgggatcaccacgggcctcctgtcgctagccacagtg
acaggcaacctgctggtactcatctctttcaaggtcaacacggagctcaagacagtcaat
aactacttcctgctgagcctggcctgtgctgacctcatcatcggtaccttctccatgaac
ctctataccacgtacctgctcatgggccactgggctctgggcacgctggcttgtgacctc
tggctggccctggactatgtggccagcaatgcctccgtcatgaatctgctgctcatcagc
tttgaccgctacttctccgtgactcggcccctgagctaccgtgccaagcgcacaccccgc
cgggcagctctgatgatcggcctggcctggctggtttcctttgtgctctgggccccagcc
atcctcttctggcagtacctggtaggggagcggacagtgctagctgggcagtgctacatc
cagttcctctcccagcccatcatcacctttggcacagccatggctgccttctacctccct
gtcacagtcatgtgcacgctctactggcgcatctaccgggagacagagaaccgagcacgg
gagctggcagcccttcagggctccgagacgccaggcaaagggggtggcagcagcagcagc
tcagagaggtctcagccaggggctgagggctcaccagagactcctccaggccgctgctgt
cgctgctgccgggcccccaggctgctgcaggcctacagctggaaggaagaagaggaagag
gacgaaggctccatggagtccctcacatcctcagagggagaggagcctggctccgaagtg
gtgatcaagatgccaatggtggaccccgaggcacaggcccccaccaagcagcccccacgg
agctccccaaatacagtcaagaggccgactaagaaagggcgtgatcgagctggcaagggc
cagaagccccgtggaaaggagcagctggccaagcggaagaccttctcgctggtcaaggag
aagaaggcggctcggaccctgagtgccatcctcctggccttcatcctcacctggacaccg
tacaacatcatggtgctggtgtccaccttctgcaaggactgtgttcccgagaccctgtgg
gagctgggctactggctgtgctacgtcaacagcaccatcaaccccatgtgctacgcactc
tgcaacaaagccttccgggacacctttcgcctgctgctgctttgccgctgggacaagaga
cgctggcgcaagatccccaagcgccctggctccgtgcaccgcactccctcccgccaatgc
tga

DBGET integrated database retrieval system