KEGG   Homo sapiens (human): 1128Help
Entry
1128              CDS       T01001                                 

Gene name
CHRM1, HM1, M1, M1R
Definition
cholinergic receptor, muscarinic 1
Orthology
K04129  
muscarinic acetylcholine receptor M1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Cholinergic synapse
Regulation of actin cytoskeleton
Drug target
Pirenzepine: 
Mebeverine: 
Trimebutine: 
Dicycloverine: 
Dihexyverine: 
Piperidolate: 
Propantheline: 
Methantheline: 
Tridihexethyl: 
Isopropamide: 
Hexocyclium: 
Mepenzolate: 
Tiemonium iodide: 
Prifinium bromide: 
Timepidium bromide: 
Atropine: 
Hyoscyamine: 
Butylscopolamine: 
Methylatropine: 
Methylscopolamine: 
Fentonium: 
Cimetropium bromide: 
Scopolamine: 
Oxybutynin: 
Propiverine: 
Trospium: 
Fesoterodine: 
Orphenadrine (citrate): 
Trihexyphenidyl: 
Biperiden: 
Metixene: 
Procyclidine: 
Profenamine: 
Dexetimide: 
Mazaticol: 
Orphenadrine (chloride): 
Benzatropine: 
Etybenzatropine: 
Chlorpromazine: 
Carbachol: 
Bethanechol: 
Pilocarpine: 
Choline alfoscerate: 
Cevimeline: 
Ipratropium bromide: 
Oxitropium bromide: 
Aclidinium bromide: 
Aceclidine: 
Acetylcholine: 
Cyclopentolate: 
Homatropine: 
Tropicamide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    1128 (CHRM1)
   04151 PI3K-Akt signaling pathway
    1128 (CHRM1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1128 (CHRM1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    1128 (CHRM1)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    1128 (CHRM1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [Table]
    1128 (CHRM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13
AA seq 460 aa AA seqDB search
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacacttcagccccacctgctgtcagccccaacatcaccgtcctggcaccaggaaag
ggtccctggcaagtggccttcattgggatcaccacgggcctcctgtcgctagccacagtg
acaggcaacctgctggtactcatctctttcaaggtcaacacggagctcaagacagtcaat
aactacttcctgctgagcctggcctgtgctgacctcatcatcggtaccttctccatgaac
ctctataccacgtacctgctcatgggccactgggctctgggcacgctggcttgtgacctc
tggctggccctggactatgtggccagcaatgcctccgtcatgaatctgctgctcatcagc
tttgaccgctacttctccgtgactcggcccctgagctaccgtgccaagcgcacaccccgc
cgggcagctctgatgatcggcctggcctggctggtttcctttgtgctctgggccccagcc
atcctcttctggcagtacctggtaggggagcggacagtgctagctgggcagtgctacatc
cagttcctctcccagcccatcatcacctttggcacagccatggctgccttctacctccct
gtcacagtcatgtgcacgctctactggcgcatctaccgggagacagagaaccgagcacgg
gagctggcagcccttcagggctccgagacgccaggcaaagggggtggcagcagcagcagc
tcagagaggtctcagccaggggctgagggctcaccagagactcctccaggccgctgctgt
cgctgctgccgggcccccaggctgctgcaggcctacagctggaaggaagaagaggaagag
gacgaaggctccatggagtccctcacatcctcagagggagaggagcctggctccgaagtg
gtgatcaagatgccaatggtggaccccgaggcacaggcccccaccaagcagcccccacgg
agctccccaaatacagtcaagaggccgactaagaaagggcgtgatcgagctggcaagggc
cagaagccccgtggaaaggagcagctggccaagcggaagaccttctcgctggtcaaggag
aagaaggcggctcggaccctgagtgccatcctcctggccttcatcctcacctggacaccg
tacaacatcatggtgctggtgtccaccttctgcaaggactgtgttcccgagaccctgtgg
gagctgggctactggctgtgctacgtcaacagcaccatcaaccccatgtgctacgcactc
tgcaacaaagccttccgggacacctttcgcctgctgctgctttgccgctgggacaagaga
cgctggcgcaagatccccaagcgccctggctccgtgcaccgcactccctcccgccaatgc
tga

DBGET integrated database retrieval system