KEGG   Homo sapiens (human): 1128Help
Entry
1128              CDS       T01001                                 

Gene name
CHRM1, HM1, M1, M1R
Definition
(RefSeq) cholinergic receptor muscarinic 1
  KO
K04129  muscarinic acetylcholine receptor M1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04725  Cholinergic synapse
hsa04810  Regulation of actin cytoskeleton
Drug target
Aceclidine: D02750
Acetylcholine (DG01133): D00999
Aclatonium (DG01291): D01955
Aclidinium bromide: D08837
Alvameline maleate: D02876
Anisotropine methylbromide: D00232
Atropine (DG00052): D00113 D02069
Atropine oxide (DG01243): D03011 D07477
Batefenterol (DG01627): D10545 D10546
Benapryzine hydrochloride: D03076
Benzatropine (DG00859): D00778 D07511
Benzetimide (DG01301): D03087 D07513
Benzilone: D03088
Bethanechol (DG00991): D01000
Bevonium: D01532
Biperiden (DG00852): D00779 D02246 D02247
Butropium bromide: D01491
Butylscopolamine: D01451
Carbachol: D00524
Carpronium (DG01289): D01175 D09752
Chlorpromazine (DG00867): D00270 D00789 D03274 D04034 D09819
Choline alfoscerate: D07349
Cimetropium bromide: D07099
Clidinium bromide: D00716
Cyclopentolate (DG01141): D01002 D07759
Darotropium bromide: D09402
Dexetimide (DG00856): D03711 D07804
Dicycloverine (DG00032): D00717 D07820
Diethazine (DG01921): D02603 D07823
Difemerine: D07079
Dihexyverine (DG00033): D03824 D07821
Diphenylpiperidinomethyldioxolan iodide: D01600
Diponium bromide: D01463
Elantrine: D03970
Elucaine: D03979
Esoxybutynin chloride: D04057
Etomidoline: D01359
Etybenzatropine: D04087
Eucatropine hydrochloride: D04116
Fenpiverinium: D07070
Fentonium: D07951
Fesoterodine (DG00483): D07226 D08923
Flutropium bromide: D02417
Heteronium bromide: D04434
Homatropine (DG01142): D01004 D02070
Hyoscyamine (DG00053): D00147 D00719 D01648 D04479
Imidafenacin: D06273
Ipratropium bromide: D02212
Mazaticol (DG00857): D03264 D08157
Mebeverine (DG00030): D04868 D08160
Mepenzolate (DG00040): D00720
Methacholine (DG01290): D04970
Methantheline (DG00036): D00721
Methscopolamine bromide: D00715
Methylatropine (DG01242): D01077 D03814
Methylbenactyzium bromide: D01315
Methylscopolamine: D01976
Metixene (DG00853): D01871 D08209
Metoquizine: D05012
Milameline hydrochloride: D05035
Otilonium bromide: D07083
Oxapium iodide: D01815
Oxitropium bromide: D01946
Oxybutynin (DG00478): D00465 D00722
Oxyphencyclimine (DG00029): D01006 D08325
Oxyphenonium: D06877
Parapenzolate bromide: D05360
Pentapiperium methylsulfate: D05418
Penthienate: D07081
Phencarbamide: D05452
Phenglutarimide: D07301
Pipenzolate: D07084
Piperidolate (DG00034): D01165 D08382
Pipethanate (DG01255): D01521 D08384
Pipethanate ethobromide: D01987
Pirenzepine (DG00026): D01297 D05276 D08389
Piroheptine (DG01272): D01231 D08395
Poldine: D05535
Pridinol (DG00774): D02064 D08418 D08419
Prifinium bromide: D01377
Procyclidine (DG00854): D00782 D08425
Profenamine (DG00855): D01118 D03276 D08426
Propantheline (DG00035): D00481
Propenzolate hydrochloride: D05628
Propiverine (DG00479): D01007 D08441
Revefenacin: D10978
Sabcomeline hydrochloride: D05779
Scopolamine (DG00065): D00138 D02071
Sofpironium bromide: D10989
Talsaclidine fumarate: D06000
Tazomeline citrate: D06015
Tematropium methylsulfate: D06061
Temiverine hydrochloride hydrate: D01926
Tiemonium (DG01254): D08595
Tiemonium iodide: D01201
Timepidium bromide (DG00041): D02535
Tofenacin hydrochloride: D06175
Toquizine: D06192
Triampyzine sulfate: D06217
Tridihexethyl (DG00037): D00723
Trihexyphenidyl (DG00851): D00787 D08638
Tropatepine (DG00858): D07303 D08653
Tropicamide: D00397
Trospium: D01103
Umeclidinium (DG01253): D10180
Umeclidinium bromide: D10181
Valethamate: D01538
Xanomeline (DG01300): D06330 D06331
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    1128 (CHRM1)
   04024 cAMP signaling pathway
    1128 (CHRM1)
   04151 PI3K-Akt signaling pathway
    1128 (CHRM1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1128 (CHRM1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    1128 (CHRM1)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    1128 (CHRM1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    1128 (CHRM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srbc 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 1128
NCBI-ProteinID: NP_000729
OMIM: 118510
HGNC: 1950
Ensembl: ENSG00000168539
Vega: OTTHUMG00000167765
Pharos: P11229(Tclin)
UniProt: P11229 Q53XZ3
Position
11q12.3
AA seq 460 aa AA seqDB search
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacacttcagccccacctgctgtcagccccaacatcaccgtcctggcaccaggaaag
ggtccctggcaagtggccttcattgggatcaccacgggcctcctgtcgctagccacagtg
acaggcaacctgctggtactcatctctttcaaggtcaacacggagctcaagacagtcaat
aactacttcctgctgagcctggcctgtgctgacctcatcatcggtaccttctccatgaac
ctctataccacgtacctgctcatgggccactgggctctgggcacgctggcttgtgacctc
tggctggccctggactatgtggccagcaatgcctccgtcatgaatctgctgctcatcagc
tttgaccgctacttctccgtgactcggcccctgagctaccgtgccaagcgcacaccccgc
cgggcagctctgatgatcggcctggcctggctggtttcctttgtgctctgggccccagcc
atcctcttctggcagtacctggtaggggagcggacagtgctagctgggcagtgctacatc
cagttcctctcccagcccatcatcacctttggcacagccatggctgccttctacctccct
gtcacagtcatgtgcacgctctactggcgcatctaccgggagacagagaaccgagcacgg
gagctggcagcccttcagggctccgagacgccaggcaaagggggtggcagcagcagcagc
tcagagaggtctcagccaggggctgagggctcaccagagactcctccaggccgctgctgt
cgctgctgccgggcccccaggctgctgcaggcctacagctggaaggaagaagaggaagag
gacgaaggctccatggagtccctcacatcctcagagggagaggagcctggctccgaagtg
gtgatcaagatgccaatggtggaccccgaggcacaggcccccaccaagcagcccccacgg
agctccccaaatacagtcaagaggccgactaagaaagggcgtgatcgagctggcaagggc
cagaagccccgtggaaaggagcagctggccaagcggaagaccttctcgctggtcaaggag
aagaaggcggctcggaccctgagtgccatcctcctggccttcatcctcacctggacaccg
tacaacatcatggtgctggtgtccaccttctgcaaggactgtgttcccgagaccctgtgg
gagctgggctactggctgtgctacgtcaacagcaccatcaaccccatgtgctacgcactc
tgcaacaaagccttccgggacacctttcgcctgctgctgctttgccgctgggacaagaga
cgctggcgcaagatccccaagcgccctggctccgtgcaccgcactccctcccgccaatgc
tga

DBGET integrated database retrieval system