KEGG   Homo sapiens (human): 11280Help
Entry
11280             CDS       T01001                                 

Gene name
SCN11A, FEPS3, HSAN7, NAV1.9, NaN, PN5, SCN12A, SNS-2
Definition
(RefSeq) sodium voltage-gated channel alpha subunit 11
  KO
K04843  
voltage-gated sodium channel type XI alpha
Organism
hsa  Homo sapiens (human)
Disease
H01391  
Familial episodic pain syndrome (FEPS)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Na+ channel, SCN alpha, NaV1.x
   11280 (SCN11A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p22.2
AA seq 1791 aa AA seqDB search
MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKKKSKDQTGEVPQPRPQLDLKASR
KLPKLYGDIPRELIGKPLEDLDPFYRNHKTFMVLNRKRTIYRFSAKHALFIFGPFNSIRS
LAIRVSVHSLFSMFIIGTVIINCVFMATGPAKNSNSNNTDIAECVFTGIYIFEALIKILA
RGFILDEFSFLRDPWNWLDSIVIGIAIVSYIPGITIKLLPLRTFRVFRALKAISVVSRLK
VIVGALLRSVKKLVNVIILTFFCLSIFALVGQQLFMGSLNLKCISRDCKNISNPEAYDHC
FEKKENSPEFKMCGIWMGNSACSIQYECKHTKINPDYNYTNFDNFGWSFLAMFRLMTQDS
WEKLYQQTLRTTGLYSVFFFIVVIFLGSFYLINLTLAVVTMAYEEQNKNVAAEIEAKEKM
FQEAQQLLKEEKEALVAMGIDRSSLTSLETSYFTPKKRKLFGNKKRKSFFLRESGKDQPP
GSDSDEDCQKKPQLLEQTKRLSQNLSLDHFDEHGDPLQRQRALSAVSILTITMKEQEKSQ
EPCLPCGENLASKYLVWNCCPQWLCVKKVLRTVMTDPFTELAITICIIINTVFLAMEHHK
MEASFEKMLNIGNLVFTSIFIAEMCLKIIALDPYHYFRRGWNIFDSIVALLSFADVMNCV
LQKRSWPFLRSFRVLRVFKLAKSWPTLNTLIKIIGNSVGALGSLTVVLVIVIFIFSVVGM
QLFGRSFNSQKSPKLCNPTGPTVSCLRHWHMGDFWHSFLVVFRILCGEWIENMWECMQEA
NASSSLCVIVFILITVIGKLVVLNLFIALLLNSFSNEERNGNLEGEARKTKVQLALDRFR
RAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVMEMKRGSETQEELGIL
TSVPKTLGVRHDWTWLAPLAEEEDDVEFSGEDNAQRITQPEPEQQAYELHQENKKPTSQR
VQSVEIDMFSEDEPHLTIQDPRKKSDVTSILSECSTIDLQDGFGWLPEMVPKKQPERCLP
KGFGCCFPCCSVDKRKPPWVIWWNLRKTCYQIVKHSWFESFIIFVILLSSGALIFEDVHL
ENQPKIQELLNCTDIIFTHIFILEMVLKWVAFGFGKYFTSAWCCLDFIIVIVSVTTLINL
MELKSFRTLRALRPLRALSQFEGMKVVVNALIGAIPAILNVLLVCLIFWLVFCILGVYFF
SGKFGKCINGTDSVINYTIITNKSQCESGNFSWINQKVNFDNVGNAYLALLQVATFKGWM
DIIYAAVDSTEKEQQPEFESNSLGYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQQKKLGG
QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKCQGLVFDIVTSQIFDIIIISLIILNM
ISMMAESYNQPKAMKSILDHLNWVFVVIFTLECLIKIFALRQYYFTNGWNLFDCVVVLLS
IVSTMISTLENQEHIPFPPTLFRIVRLARIGRILRLVRAARGIRTLLFALMMSLPSLFNI
GLLLFLIMFIYAILGMNWFSKVNPESGIDDIFNFKTFASSMLCLFQISTSAGWDSLLSPM
LRSKESCNSSSENCHLPGIATSYFVSYIIISFLIVVNMYIAVILENFNTATEESEDPLGE
DDFDIFYEVWEKFDPEATQFIKYSALSDFADALPEPLRVAKPNKYQFLVMDLPMVSEDRL
HCMDILFAFTARVLGGSDGLDSMKAMMEEKFMEANPLKKLYEPIVTTTKRKEEERGAAII
QKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD
NT seq 5376 nt NT seq  +upstreamnt  +downstreamnt
atggatgacagatgctacccagtaatctttccagatgagcggaatttccgccccttcact
tccgactctctggctgcaattgagaagcggattgccatccaaaaggagaaaaagaagtct
aaagaccagacaggagaagtaccccagcctcggcctcagcttgacctaaaggcctccagg
aagttgcccaagctctatggcgacattcctcgtgagctcataggaaagcctctggaagac
ttggacccattctaccgaaatcataagacatttatggtgttaaacagaaagaggacaatc
taccgcttcagtgccaagcatgccttgttcatttttgggcctttcaattcaatcagaagt
ttagccattagagtctcagtccattcattgttcagcatgttcattatcggcaccgttatc
atcaactgcgtgttcatggctacagggcctgctaaaaacagcaacagtaacaatactgac
attgcagagtgtgtcttcactgggatttatatttttgaagctttgattaaaatattggca
agaggtttcattctggatgagttttctttccttcgagatccatggaactggctggactcc
attgtcattggaatagcgattgtgtcatatattccaggaatcaccatcaaactattgccc
ctgcgtaccttccgtgtgttcagagctttgaaagcaatttcagtagtttcacgtctgaag
gtcatcgtgggggccttgctacgctctgtgaagaagctggtcaacgtgattatcctcacc
ttcttttgcctcagcatctttgccctggtaggtcagcagctcttcatgggaagtctgaac
ctgaaatgcatctcgagggactgtaaaaatatcagtaacccggaagcttatgaccattgc
tttgaaaagaaagaaaattcacctgaattcaaaatgtgtggcatctggatgggtaacagt
gcctgttccatacaatatgaatgtaagcacaccaaaattaatcctgactataattatacg
aattttgacaactttggctggtcttttcttgccatgttccggctgatgacccaagattcc
tgggagaagctttatcaacagaccctgcgtactactgggctctactcagtcttcttcttc
attgtggtcattttcctgggctccttctacctgattaacttaaccctggctgttgttacc
atggcatatgaggagcagaacaagaatgtagctgcagagatagaggccaaggaaaagatg
tttcaggaagcccagcagctgttaaaggaggaaaaggaggctctggttgccatgggaatt
gacagaagttcacttacttcccttgaaacatcatattttaccccaaaaaagagaaagctc
tttggtaataagaaaaggaagtccttctttttgagagagtctgggaaagaccagcctcct
gggtcagattctgatgaagattgccaaaaaaagccacagctcctagagcaaaccaaacga
ctgtcccagaatctatcactggaccactttgatgagcatggagatcctctccaaaggcag
agagcactgagtgctgtcagcatcctcaccatcaccatgaaggaacaagaaaaatcacaa
gagccttgtctcccttgtggagaaaacctggcatccaagtacctcgtgtggaactgttgc
ccccagtggctgtgcgttaagaaggtcctgagaactgtgatgactgacccgtttactgag
ctggccatcaccatctgcatcatcatcaacactgtcttcttggccatggagcatcacaag
atggaggccagttttgagaagatgttgaatatagggaatttggttttcactagcattttt
atagcagaaatgtgcctaaaaatcattgcgctcgatccctaccactactttcgccgaggc
tggaacatttttgacagcattgttgctcttctgagttttgcagatgtaatgaactgtgta
cttcaaaagagaagctggccattcttgcgttccttcagagtgctcagggtcttcaagtta
gccaaatcctggccaactttgaacacactaattaagataatcggcaactctgtcggagcc
cttggaagcctgactgtggtcctggtcattgtgatctttattttctcagtagttggcatg
cagctttttggccgtagcttcaattcccaaaagagtccaaaactctgtaacccgacaggc
ccgacagtctcatgtttacggcactggcacatgggggatttctggcactccttcctagtg
gtattccgcatcctctgcggggaatggatcgaaaatatgtgggaatgtatgcaagaagcg
aatgcatcatcatcattgtgtgttattgtcttcatattgatcacggtgataggaaaactt
gtggtgctcaacctcttcattgccttactgctcaattcctttagcaatgaggaaagaaat
ggaaacttagaaggagaggccaggaaaactaaagtccagttagcactggatcgattccgc
cgggctttttgttttgtgagacacactcttgagcatttctgtcacaagtggtgcaggaag
caaaacttaccacagcaaaaagaggtggcaggaggctgtgctgcacaaagcaaagacatc
attcccctggtcatggagatgaaaaggggctcagagacccaggaggagcttggtatacta
acctctgtaccaaagaccctgggcgtcaggcatgattggacttggttggcaccacttgcg
gaggaggaagatgacgttgaattttctggtgaagataatgcacagcgcatcacacaacct
gagcctgaacaacaggcctatgagctccatcaggagaacaagaagcccacgagccagaga
gttcaaagtgtggaaattgacatgttctctgaagatgagcctcatctgaccatacaggat
ccccgaaagaagtctgatgttaccagtatactatcagaatgtagcaccattgatcttcag
gatggctttggatggttacctgagatggttcccaaaaagcaaccagagagatgtttgccc
aaaggctttggttgctgctttccatgctgtagcgtggacaagagaaagcctccctgggtc
atttggtggaacctgcggaaaacctgctaccaaatagtgaaacacagctggtttgagagc
tttattatctttgtgattctgctgagcagtggggcactgatatttgaagatgttcacctt
gagaaccaacccaaaatccaagaattactaaattgtactgacattatttttacacatatt
tttatcctggagatggtactaaaatgggtagccttcggatttggaaagtatttcaccagt
gcctggtgctgccttgatttcatcattgtgattgtctctgtgaccaccctcattaactta
atggaattgaagtccttccggactctacgagcactgaggcctcttcgtgcgctgtcccag
tttgaaggaatgaaggtggtggtcaatgctctcataggtgccatacctgccattctgaat
gttttgcttgtctgcctcattttctggctcgtattttgtattctgggagtatacttcttt
tctggaaaatttgggaaatgcattaatggaacagactcagttataaattataccatcatt
acaaataaaagtcaatgtgaaagtggcaatttctcttggatcaaccagaaagtcaacttt
gacaatgtgggaaatgcttacctcgctctgctgcaagtggcaacatttaagggctggatg
gatattatatatgcagctgttgattccacagagaaagaacaacagccagagtttgagagc
aattcactcggttacatttacttcgtagtctttatcatctttggctcattcttcactctg
aatctcttcattggcgttatcattgacaacttcaaccaacagcagaaaaagttaggtggc
caagacatttttatgacagaagaacagaagaaatactataatgcaatgaaaaaattagga
tccaaaaaacctcaaaaacccattccacggcctctgaacaaatgtcaaggtctcgtgttc
gacatagtcacaagccagatctttgacatcatcatcataagtctcattatcctaaacatg
attagcatgatggctgaatcatacaaccaacccaaagccatgaaatccatccttgaccat
ctcaactgggtctttgtggtcatctttacgttagaatgtctcatcaaaatctttgctttg
aggcaatactacttcaccaatggctggaatttatttgactgtgtggtcgtgcttctttcc
attgttagtacaatgatttctaccttggaaaatcaggagcacattcctttccctccgacg
ctcttcagaattgtccgcttggctcggattggccgaatcctgaggcttgtccgggctgca
cgaggaatcaggactctcctctttgctctgatgatgtcgcttccttctctgttcaacatt
ggtcttctactctttctgattatgtttatctatgccattctgggtatgaactggttttcc
aaagtgaatccagagtctggaatcgatgacatattcaacttcaagacttttgccagcagc
atgctctgtctcttccagataagcacatcagcaggttgggattccctgctcagccccatg
ctgcgatcaaaagaatcatgtaactcttcctcagaaaactgccacctccctggcatagcc
acatcctactttgtcagttacattatcatctcctttctcattgttgtcaacatgtacatt
gctgtgattttagagaacttcaatacagccactgaagaaagtgaggaccctttgggtgaa
gatgactttgacatattttatgaagtgtgggaaaagtttgacccagaagcaacacaattt
atcaaatattctgccctttctgactttgctgatgccttgcctgagcctttgcgtgtcgca
aagccaaataaatatcaatttctagtaatggacttgcccatggtgagtgaagatcgcctc
cactgcatggatattcttttcgccttcaccgctagggtactcggtggctctgatggccta
gatagtatgaaagcaatgatggaagagaagttcatggaagccaatcctctcaagaagttg
tatgaacccatagtcaccaccaccaagagaaaggaagaggaaagaggtgctgctattatt
caaaaggcctttcgaaagtacatgatgaaggtgaccaagggtgaccaaggtgaccaaaat
gacttggaaaacgggcctcattcaccactccagactctttgcaatggagacttgtctagc
tttggggtggccaagggcaaggtccactgtgactga

DBGET integrated database retrieval system