KEGG   Homo sapiens (human): 1129Help
Entry
1129              CDS       T01001                                 

Gene name
CHRM2, HM2
Definition
(RefSeq) cholinergic receptor muscarinic 2
  KO
K04130  
muscarinic acetylcholine receptor M2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Cholinergic synapse
Regulation of actin cytoskeleton
Drug target
Mebeverine [DG:DG00030]: 
Trimebutine [DG:DG00031]: 
Dihexyverine [DG:DG00033]: 
Piperidolate [DG:DG00034]: 
Propantheline [DG:DG00035]: 
Methantheline [DG:DG00036]: 
Tridihexethyl [DG:DG00037]: 
Isopropamide [DG:DG00038]: 
Hexocyclium [DG:DG00039]: 
Mepenzolate [DG:DG00040]: 
Tiemonium iodide: 
Prifinium bromide: 
Timepidium bromide [DG:DG00041]: 
Valethamate: 
Atropine [DG:DG00052]: 
Hyoscyamine [DG:DG00053]: 
Butylscopolamine: 
Methylatropine [DG:DG01242]: 
Methylscopolamine: 
Fentonium: 
Cimetropium bromide: 
Scopolamine [DG:DG00065]: 
Oxybutynin [DG:DG00478]: 
Propiverine [DG:DG00479]: 
Trospium: 
Fesoterodine [DG:DG00483]: 
Orphenadrine (citrate): 
Trihexyphenidyl [DG:DG00851]: 
Biperiden [DG:DG00852]: 
Metixene [DG:DG00853]: 
Procyclidine [DG:DG00854]: 
Profenamine [DG:DG00855]: 
Dexetimide [DG:DG00856]: 
Mazaticol [DG:DG00857]: 
Orphenadrine (chloride): 
Benzatropine [DG:DG00859]: 
Etybenzatropine: 
Chlorpromazine [DG:DG00867]: 
Carbachol: 
Bethanechol [DG:DG00991]: 
Pilocarpine [DG:DG00992]: 
Choline alfoscerate: 
Ipratropium bromide: 
Oxitropium bromide: 
Aclidinium bromide: 
Umeclidinium bromide: 
Acetylcholine [DG:DG01133]: 
Cyclopentolate [DG:DG01141]: 
Homatropine [DG:DG01142]: 
Tropicamide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    1129 (CHRM2)
   04024 cAMP signaling pathway
    1129 (CHRM2)
   04151 PI3K-Akt signaling pathway
    1129 (CHRM2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1129 (CHRM2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    1129 (CHRM2)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    1129 (CHRM2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    1129 (CHRM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q31-q35
AA seq 466 aa AA seqDB search
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaataactcaacaaactcctctaacaatagcctggctcttacaagtccttataagaca
tttgaagtggtgtttattgtcctggtggctggatccctcagtttggtgaccattatcggg
aacatcctagtcatggtttccattaaagtcaaccgccacctccagaccgtcaacaattac
tttttattcagcttggcctgtgctgaccttatcataggtgttttctccatgaacttgtac
accctctacactgtgattggttactggcctttgggacctgtggtgtgtgacctttggcta
gccctggactatgtggtcagcaatgcctcagttatgaatctgctcatcatcagctttgac
aggtacttctgtgtcacaaaacctctgacctacccagtcaagcggaccacaaaaatggca
ggtatgatgattgcagctgcctgggtcctctctttcatcctctgggctccagccattctc
ttctggcagttcattgtaggggtgagaactgtggaggatggggagtgctacattcagttt
ttttccaatgctgctgtcacctttggtacggctattgcagccttctatttgccagtgatc
atcatgactgtgctatattggcacatatcccgagccagcaagagcaggataaagaaggac
aagaaggagcctgttgccaaccaagaccccgtttctccaagtctggtacaaggaaggata
gtgaagccaaacaataacaacatgcccagcagtgacgatggcctggagcacaacaaaatc
cagaatggcaaagcccccagggatcctgtgactgaaaactgtgttcagggagaggagaag
gagagctccaatgactccacctcagtcagtgctgttgcctctaatatgagagatgatgaa
ataacccaggatgaaaacacagtttccacttccctgggccattccaaagatgagaactct
aagcaaacatgcatcagaattggcaccaagaccccaaaaagtgactcatgtaccccaact
aataccaccgtggaggtagtggggtcttcaggtcagaatggagatgaaaagcagaatatt
gtagcccgcaagattgtgaagatgactaagcagcctgcaaaaaagaagcctcctccttcc
cgggaaaagaaagtcaccaggacaatcttggctattctgttggctttcatcatcacttgg
gccccatacaatgtcatggtgctcattaacaccttttgtgcaccttgcatccccaacact
gtgtggacaattggttactggctttgttacatcaacagcactatcaaccctgcctgctat
gcactttgcaatgccaccttcaagaagacctttaaacaccttctcatgtgtcattataag
aacataggcgctacaaggtaa

DBGET integrated database retrieval system