KEGG   Homo sapiens (human): 113026Help
Entry
113026            CDS       T01001                                 

Gene name
PLCD3, PLC-delta-3
Definition
phospholipase C, delta 3 (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113026 (PLCD3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    113026 (PLCD3)
   04070 Phosphatidylinositol signaling system
    113026 (PLCD3)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    113026 (PLCD3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     113026 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
17q21.31
AA seq 789 aa AA seqDB search
MLCGRWRRCRRPPEEPPVAAQVAAQVAAPVALPSPPTPSDGGTKRPGLRALKKMGLTEDE
DVRAMLRGSRLRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAVREG
HQSEGLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQR
ERLDHWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFKECDHSNNDRLEG
AEIEEFLRRLLKRPELEEIFHQYSGEDRVLSAPELLEFLEDQGEEGATLARAQQLIQTYE
LNETAKQHELMTLDGFMMYLLSPEGAALDNTHTCVFQDMNQPLAHYFISSSHNTYLTDSQ
IGGPSSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVVQAVRDHAFT
LSPYPVILSLENHCGLEQQAAMARHLCTILGDMLVTQALDSPNPEELPSPEQLKGRVLVK
GKKLPAARSEDGRALSDREEEEEDDEEEEEEVEAAAQRRLAKQISPELSALAVYCHATRL
RTLHPAPNAPQPCQVSSLSERKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNSANYSPQ
EMWNSGCQLVALNFQTPGYEMDLNAGRFLVNGQCGYVLKPACLRQPDSTFDPEYPGPPRT
TLSIQVLTAQQLPKLNAEKPHSIVDPLVRIEIHGVPADCARQETDYVLNNGFNPRWGQTL
QFQLRAPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSKDGASLSPATL
FIQIRIQRS
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcggccgctggaggcgttgccgccgcccgcccgaggagcccccggtggccgcc
caggtcgcagcccaagtcgcggcgccggtcgctctcccgtccccgccgactccctccgat
ggcggcaccaagaggcccgggctgcgggcgctgaagaagatgggcctgacggaggacgag
gacgtgcgcgccatgctgcggggctcccggctccgcaagatccgctcgcgcacgtggcac
aaggagcggctgtaccggctgcaggaggacggcctgagcgtgtggttccagcggcgcatc
ccgcgtgcgccatcgcagcacatcttcttcgtgcagcacatcgaggcggtccgcgagggc
caccagtccgagggcctgcggcgcttcgggggtgccttcgcgccagcgcgctgcctcacc
atcgccttcaagggccgccgcaagaacctggacctggcggcgcccacggctgaggaagcg
cagcgctgggtgcgcggtctgaccaagctccgcgcgcgcctggacgccatgagccagcgc
gagcggctagaccactggatccactcctatctgcaccgggctgactccaaccaggacagc
aagatgagcttcaaggagatcaagagcctgctgagaatggtcaacgtggacatgaacgac
atgtacgcctacctcctcttcaaggagtgtgaccactccaacaacgaccgtctagagggg
gctgagatcgaggagttcctgcggcggctgctgaagcggccggagctggaggagatcttc
catcagtactcgggcgaggaccgcgtgctgagtgcccctgagctgctggagttcctggag
gaccagggcgaggagggcgccacactggcccgcgcccagcagctcattcagacctatgag
ctcaacgagacagccaagcagcatgagctgatgacactggatggcttcatgatgtacctg
ttgtcgccggagggggctgccttggacaacacccacacgtgtgtgttccaggacatgaac
cagccccttgcccactacttcatctcttcctcccacaacacctatctgactgactcccag
atcggggggcccagcagcaccgaggcctatgttagggcctttgcccagggatgccgctgc
gtggagctggactgctgggaggggccaggaggggagcccgtcatctatcatggccatacc
ctcacctccaagattctcttccgggacgtggtccaagccgtgcgcgaccatgccttcacg
ctgtccccttaccctgtcatcctatccctggagaaccactgcgggctggagcagcaggct
gccatggcccgccacctctgcaccatcctgggggacatgctggtgacacaggcgctggac
tccccaaatcccgaggagctgccatccccagagcagctgaagggccgggtcctggtgaag
ggaaagaagttgcccgctgctcggagcgaggatggccgggctctgtcggatcgggaggag
gaggaggaggatgacgaggaggaagaagaggaggtggaggctgcagcgcagaggcggctg
gccaagcagatctccccggagctgtcggccctggctgtgtactgccacgccacccgcctg
cggaccctgcaccctgcccccaacgccccacaaccctgccaggtcagctccctcagcgag
cgcaaagccaagaaactcattcgggaggcagggaacagctttgtcaggcacaatgcccgc
cagctgacccgcgtgtacccgctggggctgcggatgaactcagccaactacagtccccag
gagatgtggaactcgggctgtcagctggtggccttgaacttccagacgccaggctacgag
atggacctcaatgccgggcgcttcctagtcaatgggcagtgtggctacgtcctaaaacct
gcctgcctgcggcaacctgactcgacctttgaccccgagtacccaggacctcccagaacc
actctcagcatccaggtgctgactgcacagcagctgcccaagctgaatgccgagaagcca
cactccattgtggaccccctggtgcgcattgagatccatggggtgcccgcagactgtgcc
cggcaggagactgactacgtgctcaacaatggcttcaacccccgctgggggcagaccctg
cagttccagctgcgggctccggagctggcactggtccggtttgtggtggaagattatgac
gccacctcccccaatgactttgtgggccagtttacactgcctcttagcagcctaaagcaa
gggtaccgccacatacacctgctttccaaggacggggcctcactgtcaccagccacgctc
ttcatccaaatccgcatccagcgctcctga

DBGET integrated database retrieval system