KEGG   Homo sapiens (human): 11311Help
Entry
11311             CDS       T01001                                 

Gene name
VPS45, H1, H1VPS45, SCN5, VPS45A, VPS45B, VPS54A, VSP45, VSP45A
Definition
(RefSeq) vacuolar protein sorting 45 homolog (S. cerevisiae)
  KO
K12479  
vacuolar protein sorting-associated protein 45
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    11311 (VPS45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21.2
AA seq 570 aa AA seqDB search
MNVVFAVKQYISKMIEDSGPGMKVLLMDKETTGIVSMVYTQSEILQKEVYLFERIDSQNR
EIMKHLKAICFLRPTKENVDYIIQELRRPKYTIYFIYFSNVISKSDVKSLAEADEQEVVA
EVQEFYGDYIAVNPHLFSLNILGCCQGRNWDPAQLSRTTQGLTALLLSLKKCPMIRYQLS
SEAAKRLAECVKQVITKEYELFEFRRTEVPPLLLILDRCDDAITPLLNQWTYQAMVHELL
GINNNRIDLSRVPGISKDLREVVLSAENDEFYANNMYLNFAEIGSNIKNLMEDFQKKKPK
EQQKLESIADMKAFVENYPQFKKMSGTVSKHVTVVGELSRLVSERNLLEVSEVEQELACQ
NDHSSALQNIKRLLQNPKVTEFDAARLVMLYALHYERHSSNSLPGLMMDLRNKGVSEKYR
KLVSAVVEYGGKRVRGSDLFSPKDAVAITKQFLKGLKGVENVYTQHQPFLHETLDHLIKG
RLKENLYPYLGPSTLRDRPQDIIVFVIGGATYEEALTVYNLNRTTPGVRIVLGGTTVHNT
KSFLEEVLASGLHSRSKESSQVTSRSASRR
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtggtttttgctgtgaagcagtacatttccaaaatgatagaggacagcgggcct
ggtatgaaagtacttctcatggataaagagacgactggcatagtgagtatggtatacaca
caatcggagattctacagaaggaagtgtacctctttgaacgcattgattctcaaaatcga
gagatcatgaaacacctgaaggcaatttgttttcttcgacctacaaaggagaatgtggat
tatattattcaggagctccgaagacccaaatacactatatatttcatttatttcagtaat
gtgatcagcaagagtgacgtgaagtcattggctgaagctgatgaacaggaagttgtggct
gaggttcaggaattttatggtgattacattgctgtgaacccacatttgttttccctcaat
attttgggttgctgccagggtcgaaattgggatccagcccagctatctagaacaactcaa
gggcttacagctctccttttatctctgaagaagtgtcccatgattcgttatcagctctca
tcagaggcagcaaagagacttgcagagtgcgttaagcaagtgataactaaagaatatgaa
ctgtttgaattccgtcggacagaggttcctccattgctccttattttagatcgctgtgat
gatgccatcaccccattgctaaaccagtggacatatcaggccatggtccacgaactacta
ggcataaacaacaatcggattgatctttccagagtgccgggaatcagtaaagacttaaga
gaagtggtcctatctgctgaaaatgatgaattctatgctaataatatgtacctgaacttt
gctgagattggtagcaatataaagaatctcatggaagattttcagaagaagaaaccaaaa
gaacagcaaaaactagaatcaatagcagacatgaaggcgtttgttgagaattatccacag
ttcaagaaaatgtctgggactgtttcaaagcatgtgacagtggttggagaactgtctcga
ttggtcagtgaacggaatctgctggaggtttcagaggttgagcaagaactggcctgtcaa
aatgaccattctagtgctctccagaatataaaaaggcttctgcagaaccccaaagtgaca
gagtttgatgctgcccgcctggtgatgctttatgctttacattatgagcgacacagcagc
aatagcctgccaggactaatgatggacctcaggaataaaggtgtttctgagaagtatcga
aagctcgtgtctgcagttgttgaatatggtggtaaacgagtcagaggaagtgacctcttc
agccccaaagatgctgtggctatcaccaaacaattcctcaaaggactgaagggagtagaa
aatgtatatacacagcatcaacctttcctacatgaaaccctggatcatctcatcaaagga
aggcttaaggaaaacctatatccttatttaggccccagcacactcagagacagacctcag
gatatcattgtgtttgtaattggaggagccacctatgaagaggctctaacagtttataac
ctgaaccgcaccactcctggagtgaggattgtcctgggaggcaccacagtgcacaacacg
aaaagtttcctagaggaagttctggcttctggactgcacagccgaagcaaggagagctct
caagtcacatcaaggtcagcgagcagaagatga

DBGET integrated database retrieval system