KEGG   Homo sapiens (human): 11313Help
Entry
11313             CDS       T01001                                 

Gene name
LYPLA2, APT-2, DJ886K2.4
Definition
lysophospholipase II (EC:3.1.1.5)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    11313 (LYPLA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     11313 (LYPLA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.11
AA seq 231 aa AA seqDB search
MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGG
FSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP
VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtaacaccatgtctgtgcccctgctcaccgatgctgccaccgtgtctggagct
gagcgggaaacggccgcggttatttttttacatggacttggagacacagggcacagctgg
gctgacgccctctccaccatccggctccctcacgtcaagtacatctgtccccatgcgcct
aggatccctgtgaccctcaacatgaagatggtgatgccctcctggtttgacctgatgggg
ctgagtccagatgccccagaggacgaggctggcatcaagaaggcagcagagaacatcaag
gccttgattgagcatgaaatgaagaacgggatccctgccaatcgaatcgtcctgggaggc
ttttcacagggcggggccctgtccctctacacggccctcacctgcccccaccctctggct
ggcatcgtggcgttgagctgctggctgcctctgcaccgggccttcccccaggcagctaat
ggcagtgccaaggacctggccatactccagtgccatggggagctggaccccatggtgccc
gtacggtttggggccctgacggctgagaagctccggtctgttgtcacacctgccagggtc
cagttcaagacatacccgggtgtcatgcacagctcctgtcctcaggagatggcagctgtg
aaggaatttcttgagaagctgctgcctcctgtctaa

DBGET integrated database retrieval system