KEGG   Homo sapiens (human): 11314Help
Entry
11314             CDS       T01001                                 

Gene name
CD300A, CLM-8, CMRF-35-H9, CMRF-35H, CMRF35-H, CMRF35-H9, CMRF35H, CMRF35H9, IGSF12, IRC1, IRC1/IRC2, IRC2, IRp60
Definition
CD300a molecule
Orthology
K06719  
CD300 antigen
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.1
AA seq 186 aa AA seqDB search
MWLPWALLLLWVPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEE
VVNSQLPLLLSLLALLLLLLVGASLLAWRMFQKWIKAGDHSELSQNPKQAATQSELHYAN
LELLMWPLQEKPAPPREVEVEYSTVASPREELHYASVVFDSNTNRIAAQRPREEEPDSDY
SVIRKT
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgccttgggctctgttgcttctctgggtcccagcatcaacgtcaatgacacct
gcaagtatcactgcggccaagacctcaacaatcacaactgcatttccacctgtatcatcc
actaccctgtttgcagtgggtgccacccacagtgccagcatccaggaggaaactgaggag
gtggtgaactcacagctcccgctgctcctctccctgctggcattgttgctgcttctgttg
gtgggggcctccctgctagcctggaggatgtttcagaaatggatcaaagctggtgaccat
tcagagctgtcccagaaccccaagcaggctgccacgcagagtgagctgcactacgcaaat
ctggagctgctgatgtggcctctgcaggaaaagccagcaccaccaagggaggtggaggtg
gaatacagcactgtggcctcccccagggaagaacttcactatgcctcggtggtgtttgat
tctaacaccaacaggatagctgctcagaggcctcgggaggaggaaccagattcagattac
agtgtgataaggaagacatag

DBGET integrated database retrieval system