KEGG   Homo sapiens (human): 11317Help
Entry
11317             CDS       T01001                                 

Gene name
RBPJL, RBPSUHL, SUHL
Definition
recombination signal binding protein for immunoglobulin kappa J region-like
Orthology
K06053  
recombining binding protein suppressor of hairless
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    11317 (RBPJL)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    11317 (RBPJL)
  Infectious diseases
   05169 Epstein-Barr virus infection
    11317 (RBPJL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Position
20q13.12
AA seq 471 aa AA seqDB search
MDPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTTILRGGVRRC
LQQQCEQTVRILHAKVAQKSYGNEKRFFCPPPCVYLSGPGWRVKPGQDQAHQAGETGPTV
CGYMGLDSASGSATETQKLNFEQQPDSREFGCAKTLYISDADKRKHFRLVLRLVLRGGRE
LGTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVSTRYLSVEDGAFVA
SARQWAAFTLHLADGHSAQGDFPPREGYVRYGSLVQLVCTVTGITLPPMIIRKVAKQCAL
LDVDEPISQLHKCAFQFPGSPPGGGGTYLCLATEKVVQFQASPCPKEANRALLNDSSCWT
IIGTESVEFSFSTSLACTLEPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGDV
EAETMYRYGVEPAVPGVRGAGRGGLLQRLALAARSHHNPHEPGARRRALLP
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgcaggggcagcagacccctcagtgcctcccaatcctttgactcacctgagc
ctgcaggacagatcagagatgcagctgcagagcgaagccgacaggcggagcctcccgggc
acttggaccaggtcatccccagagcacaccaccattctgaggggaggcgtgcgcaggtgc
ctgcagcaacagtgtgaacagactgtgcggatcctgcatgccaaggtggcccagaaatca
tacggaaatgagaagcggttcttctgccccccgccctgtgtctacctctcggggcctggc
tggagggtgaagccagggcaggatcaagctcaccaggcgggggaaacggggcccacggtc
tgcggttacatgggactggacagcgcgtccggcagcgccactgagacgcagaagctgaat
ttcgagcagcagccggactccagggaattcggctgcgccaagaccctgtacatctcagat
gcagacaagaggaagcactttcggctggtgctgcggctggtgctgcgcgggggccgggag
ctgggtaccttccacagccgccttatcaaggtcatctcgaagccctcgcagaagaagcag
tcgctgaaaaacaccgatctgtgcatatcctccggctcaaaggtctccctcttcaaccgc
ctgcgctctcagacggtctccacacgctacctctctgtggaggatggggcctttgtggcc
agtgcacgacagtgggctgccttcacgctccacctggctgatgggcactctgcccaagga
gacttcccaccgcgagagggctacgttcgctatggctccctggtgcagctcgtctgcacg
gtcaccggcatcacactacctcccatgatcatccgtaaagtagcaaaacagtgtgcgctc
cttgatgtggatgagcccatctcccagctgcacaagtgtgcattccagtttccaggcagt
cccccaggagggggtggcacctacttatgccttgccacagagaaggtggtgcaatttcag
gcctctccctgccccaaggaggcgaacagggctctgcttaacgacagctcttgctggacc
atcatcggcaccgagtcggtggaattttccttcagcaccagcctggcgtgtaccctggag
ccggtcactccggtgcctctcatcagcaccctagagctgagcggcgggggcgacgtggcc
acgctggagctccacggagagaacttccacgcggggctcaaggtgtggtttggggacgtg
gaggcagaaaccatgtacaggtacggggtggagcccgcggtccctggtgtgcgtggtgcc
ggacgtggcggccttctgcagcgactggcgctggctgcgcgctcccatcacaatccccat
gagcctggtgcgcgccgacgggctcttctaccctag

DBGET integrated database retrieval system