KEGG   Homo sapiens (human): 11317Help
Entry
11317             CDS       T01001                                 

Gene name
RBPJL, RBPL, RBPSUHL, SUHL
Definition
(RefSeq) recombination signal binding protein for immunoglobulin kappa J region like
  KO
K06053  
recombining binding protein suppressor of hairless
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Th1 and Th2 cell differentiation
Epstein-Barr virus infection
Viral carcinogenesis
Module
Notch signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    11317 (RBPJL)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    11317 (RBPJL)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    11317 (RBPJL)
  Infectious diseases
   05169 Epstein-Barr virus infection
    11317 (RBPJL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.12
AA seq 517 aa AA seqDB search
MDPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTTILRGGVRRC
LQQQCEQTVRILHAKVAQKSYGNEKRFFCPPPCVYLSGPGWRVKPGQDQAHQAGETGPTV
CGYMGLDSASGSATETQKLNFEQQPDSREFGCAKTLYISDADKRKHFRLVLRLVLRGGRE
LGTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVSTRYLSVEDGAFVA
SARQWAAFTLHLADGHSAQGDFPPREGYVRYGSLVQLVCTVTGITLPPMIIRKVAKQCAL
LDVDEPISQLHKCAFQFPGSPPGGGGTYLCLATEKVVQFQASPCPKEANRALLNDSSCWT
IIGTESVEFSFSTSLACTLEPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGDV
EAETMYRSPRSLVCVVPDVAAFCSDWRWLRAPITIPMSLVRADGLFYPSAFSFTYTPEYS
VRPGHPGVPEPATDADALLESIHQEFTRTNFHLFIQT
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgcaggggcagcagacccctcagtgcctcccaatcctttgactcacctgagc
ctgcaggacagatcagagatgcagctgcagagcgaagccgacaggcggagcctcccgggc
acttggaccaggtcatccccagagcacaccaccattctgaggggaggcgtgcgcaggtgc
ctgcagcaacagtgtgaacagactgtgcggatcctgcatgccaaggtggcccagaaatca
tacggaaatgagaagcggttcttctgccccccgccctgtgtctacctctcggggcctggc
tggagggtgaagccagggcaggatcaagctcaccaggcgggggaaacggggcccacggtc
tgcggttacatgggactggacagcgcgtccggcagcgccactgagacgcagaagctgaat
ttcgagcagcagccggactccagggaattcggctgcgccaagaccctgtacatctcagat
gcagacaagaggaagcactttcggctggtgctgcggctggtgctgcgcgggggccgggag
ctgggtaccttccacagccgccttatcaaggtcatctcgaagccctcgcagaagaagcag
tcgctgaaaaacaccgatctgtgcatatcctccggctcaaaggtctccctcttcaaccgc
ctgcgctctcagacggtctccacacgctacctctctgtggaggatggggcctttgtggcc
agtgcacgacagtgggctgccttcacgctccacctggctgatgggcactctgcccaagga
gacttcccaccgcgagagggctacgttcgctatggctccctggtgcagctcgtctgcacg
gtcaccggcatcacactacctcccatgatcatccgtaaagtagcaaaacagtgtgcgctc
cttgatgtggatgagcccatctcccagctgcacaagtgtgcattccagtttccaggcagt
cccccaggagggggtggcacctacttatgccttgccacagagaaggtggtgcaatttcag
gcctctccctgccccaaggaggcgaacagggctctgcttaacgacagctcttgctggacc
atcatcggcaccgagtcggtggaattttccttcagcaccagcctggcgtgtaccctggag
ccggtcactccggtgcctctcatcagcaccctagagctgagcggcgggggcgacgtggcc
acgctggagctccacggagagaacttccacgcggggctcaaggtgtggtttggggacgtg
gaggcagaaaccatgtacaggagcccgcggtccctggtgtgcgtggtgccggacgtggcg
gccttctgcagcgactggcgctggctgcgcgctcccatcacaatccccatgagcctggtg
cgcgccgacgggctcttctaccctagtgccttctccttcacctacaccccggaatacagc
gtgcggccgggtcaccccggcgtccccgagcccgccaccgacgccgacgcgctcctggag
agcatccatcaggagttcacgcgcaccaacttccacctcttcatccagacttag

DBGET integrated database retrieval system