KEGG   Homo sapiens (human): 113179Help
Entry
113179            CDS       T01001                                 

Gene name
ADAT3, FWP005, MRT36, MST121, MSTP121, S863-5, TAD3
Definition
(RefSeq) adenosine deaminase, tRNA specific 3
  KO
K15442  
tRNA-specific adenosine deaminase 3
Organism
hsa  Homo sapiens (human)
Brite
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA modification factors
   Deaminases
    113179 (ADAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 367 aa AA seqDB search
MILCSRLCLPQSASLRMEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVL
AYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLLCLAGPASGPR
SLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQVTSALAGRL
FSTQERAAMQSHMERAVWAARRAAARGLRAVGAVVVDPASDRVLATGHDCSCADNPLLHA
VMVCVDLVARGQGRGTYDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDL
YVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQC
RWLDPDT
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgatcctctgctcccgtctctgtctcccacagtcggcctcgctgaggatggagcccgcc
ccgggcctcgtggagcagcccaagtgcttggaggccgggagcccggagcctgagccggcg
ccgtggcaggccctccctgtcctgtccgagaagcagtcaggggacgtggagctggtgctg
gcctacgccgcgcccgtcctggacaagcgccagacctcacgcctcctgaaggaggtgtcg
gccctgcacccgctccccgcccagcctcacctcaagcgggtgcggcccagccgcgatgcc
ggcagcccccacgccctggagatgctgctttgcctggctgggccggcctcgggcccgcgc
tcgctggctgagctcctgccacggccggctgtggacccccgcggcctggggcaacccttc
ctggtgcccgtgcccgcccggccgcctctgaccaggggccagttcgaggaggcccgggcc
cactggcccacgtccttccacgaggacaagcaggtgaccagcgccctggctgggcggctc
ttctccacgcaggagcgcgccgccatgcagagccacatggagcgggcggtgtgggcggcc
cggcgggcagcagcgcggggcttgcgggccgtgggggccgtggtagtggacccggcctcg
gaccgcgtgctggccaccggccacgactgcagctgcgcggacaaccccctcctgcacgcc
gtcatggtgtgcgtggacctcgtggcgcgcggccagggccgcggcacctacgacttcaga
cccttccccgcctgctccttcgccccggccgctgccccccaggccgtccgcgcaggcgcc
gtgcgtaaactggacgcagacgaggacggcctcccctacctgtgcactggctacgacctg
tacgtgacccgcgagccctgcgccatgtgcgccatggccctggtgcacgcacgcatcctg
cgcgtcttctacggtgcgccctcgcccgacggcgccctgggcacccgcttccgcatccac
gcacggcccgacctcaaccaccgcttccaggtgttccgcggggtgctggaggagcagtgc
cgctggctggaccccgacacgtag

DBGET integrated database retrieval system