KEGG   Homo sapiens (human): 113189Help
Entry
113189            CDS       T01001                                 

Gene name
CHST14, ATCS, D4ST1, EDSMC1, HNK1ST
Definition
carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 (EC:2.8.2.35)
Orthology
K08105  
dermatan 4-sulfotransferase 1 [EC:2.8.2.35]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Disease
H00802  
Ehlers-Danlos syndrome (EDS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    113189 (CHST14)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.35  dermatan 4-sulfotransferase
     113189 (CHST14)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   113189 (CHST14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Position
15q15.1
AA seq 376 aa AA seqDB search
MFPRPLTPLAAPNGAEPLGRALRRAPLGRARAGLGGPPLLLPSMLMFAVIVASSGLLLMI
ERGILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQP
GMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVMKVLAGVLDSVDVRL
KMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVREPLERLLSAYRNKFGEIREYQQRYGAE
IVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYE
RLEADANQVLEWVRAPPHVRFPARQAWYRPASPESLHYHLCSAPRALLQDVLPKYILDFS
LFAYPLPNVTKEACQQ
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgttcccccgcccgctgaccccgctggcggccccaaatggcgccgagcccctgggccgg
gcgctgaggcgggcccctctgggcagggcccgggcggggctgggtgggccgcccctgctg
ctgccgtccatgctgatgtttgcggtgatcgtggcctccagcgggctgctgctcatgatc
gagcggggcatcctggccgagatgaagcccctgcccctgcacccgcccggccgcgagggc
acagcctggcgcgggaaagcccccaagcctgggggcctgtccctcagggctggggacgcg
gacttgcaagtgcggcaggacgtccggaacaggaccctgcgggcggtgtgcggacagcca
ggcatgccccgggacccctgggacttgccggtggggcagcggcgcaccctgctgcgccac
atcctcgtaagtgaccgttaccgcttcctctactgctacgtccccaaggtggcctgctct
aactggaagcgggtgatgaaggtgctggcaggcgtcctggacagcgtggacgtccgcctc
aagatggaccaccgcagtgacctggtgttcctggccgacctgcggcctgaggagattcgc
taccgcctgcagcactactttaagttcctgtttgtgcgggagcccttggaacgcctcctc
tctgcctaccgcaacaagtttggcgagatccgagagtaccagcaacgctatggggctgag
atagtgaggcggtacagggctggagcggggcccagccctgcaggcgacgatgtcacattc
cccgagttcctgagatacctggtggatgaggaccctgagcgcatgaatgagcattggatg
cccgtgtaccacctgtgccagccttgtgccgtgcactatgactttgtgggctcctatgag
aggctggaggctgatgcaaatcaggtgctggagtgggtacgggcaccacctcacgtccga
tttccagctcgccaggcctggtaccggccagccagccccgaaagcctgcattaccacttg
tgcagtgccccccgggccctgctgcaggatgtgctgcctaagtatatcctggacttctcc
ctctttgcctacccactgcctaatgtcaccaaggaggcgtgtcagcagtga

DBGET integrated database retrieval system