KEGG   Homo sapiens (human): 1132Help
Entry
1132              CDS       T01001                                 

Gene name
CHRM4, HM4, M4R
Definition
cholinergic receptor, muscarinic 4
Orthology
K04132  
muscarinic acetylcholine receptor M4
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Regulation of actin cytoskeleton
Drug target
Mebeverine: 
Trimebutine: 
Dihexyverine: 
Piperidolate: 
Propantheline: 
Methantheline: 
Tridihexethyl: 
Isopropamide: 
Hexocyclium: 
Mepenzolate: 
Tiemonium iodide: 
Prifinium bromide: 
Timepidium bromide: 
Atropine: 
Hyoscyamine: 
Butylscopolamine: 
Methylatropine: 
Methylscopolamine: 
Fentonium: 
Cimetropium bromide: 
Scopolamine: 
Propiverine: 
Trospium: 
Fesoterodine: 
Orphenadrine (citrate): 
Trihexyphenidyl: 
Biperiden: 
Metixene: 
Procyclidine: 
Profenamine: 
Dexetimide: 
Mazaticol: 
Orphenadrine (chloride): 
Benzatropine: 
Etybenzatropine: 
Chlorpromazine: 
Carbachol: 
Bethanechol: 
Pilocarpine: 
Choline alfoscerate: 
Ipratropium bromide: 
Oxitropium bromide: 
Aclidinium bromide: 
Acetylcholine: 
Cyclopentolate: 
Homatropine: 
Tropicamide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1132 (CHRM4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    1132 (CHRM4)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    1132 (CHRM4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    1132 (CHRM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p12-p11.2
AA seq 479 aa AA seqDB search
MANFTPVNGSSGNQSVRLVTSSSHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVN
RQLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASV
MNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTV
PDNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAK
TLAFLKSPLMKQSVKKPPPGEAAREELRNGKLEEAPPPALPPPPRPVADKDTSNESSSGS
ATQNTKERPATELSTTEATTPAMPAPPLQPRALNPASRWSKIQIVTKQTGNECVTAIEIV
PATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV
LVNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggccaacttcacacctgtcaatggcagctcgggcaatcagtccgtgcgcctggtcacg
tcatcatcccacaatcgctatgagacggtggaaatggtcttcattgccacagtgacaggc
tccctgagcctggtgactgtcgtgggcaacatcctggtgatgctgtccatcaaggtcaac
aggcagctgcagacagtcaacaactacttcctcttcagcctggcgtgtgctgatctcatc
ataggcgccttctccatgaacctctacaccgtgtacatcatcaagggctactggcccctg
ggcgccgtggtctgcgacctgtggctggccctggactacgtggtgagcaacgcctccgtc
atgaaccttctcatcatcagctttgaccgctacttctgcgtcaccaagcctctcacctac
cctgcccggcgcaccaccaagatggcaggcctcatgattgctgctgcctgggtactgtcc
ttcgtgctctgggcgcctgccatcttgttctggcagtttgtggtgggtaagcggacggtg
cccgacaaccagtgcttcatccagttcctgtccaacccagcagtgacctttggcacagcc
attgctgccttctacctgcctgtggtcatcatgacggtgctgtacatccacatctccctg
gccagtcgcagccgagtccacaagcaccggcccgagggcccgaaggagaagaaagccaag
acgctggccttcctcaagagcccactaatgaagcagagcgtcaagaagcccccgcccggg
gaggccgcccgggaggagctgcgcaatggcaagctggaggaggcccccccgccagcgctg
ccaccgccaccgcgccccgtggctgataaggacacttccaatgagtccagctcaggcagt
gccacccagaacaccaaggaacgcccagccacagagctgtccaccacagaggccaccacg
cccgccatgcccgcccctcccctgcagccgcgggccctcaacccagcctccagatggtcc
aagatccagattgtgacgaagcagacaggcaatgagtgtgtgacagccattgagattgtg
cctgccacgccggctggcatgcgccctgcggccaacgtggcccgcaagttcgccagcatc
gctcgcaaccaggtgcgcaagaagcggcagatggcggcccgggagcgcaaagtgacacga
acgatctttgccattctgctagccttcatcctcacctggacgccctacaacgtcatggtc
ctggtgaacaccttctgccagagctgcatccctgacacggtgtggtccattggctactgg
ctctgctacgtcaacagcaccatcaaccctgcctgctatgctctgtgcaacgccaccttt
aaaaagaccttccggcacctgctgctgtgccagtatcggaacatcggcactgccaggtag

DBGET integrated database retrieval system