KEGG   Homo sapiens (human): 11329Help
Entry
11329             CDS       T01001                                 

Gene name
STK38, NDR, NDR1
Definition
(RefSeq) serine/threonine kinase 38 (EC:2.7.11.1)
  KO
K08790  
serine/threonine kinase 38 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11329 (STK38)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  NDR family
   11329 (STK38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21
AA seq 465 aa AA seqDB search
MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDE
EKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKIL
RKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMK
KDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKA
HRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYN
KLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRF
CCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILK
PTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgacaggctcaacaccttgctcatccatgagtaaccacacaaaggaaagggtg
acaatgaccaaagtgacactggagaatttttatagcaaccttatcgctcaacatgaagaa
cgagaaatgagacaaaagaagttagaaaaggtgatggaagaagaaggcctaaaagatgag
gagaaacgactccggagatcagcacatgctcggaaggaaacagagtttcttcgtttgaag
agaacaagacttggattggaagattttgagtccttaaaagtaataggcagaggagcattt
ggtgaggtacggcttgttcagaagaaagatacgggacatgtgtatgcaatgaaaatactc
cgtaaagcagatatgcttgaaaaagagcaggttggccacattcgtgcggagcgtgacatt
ctagtggaggcagacagtttgtgggttgtgaaaatgttctatagttttcaggataagcta
aacctctacctaatcatggagttcctgcctggaggggacatgatgaccttgttgatgaaa
aaagacactctgacagaagaggagactcagttttatatagcagaaacagtattagccata
gactctattcaccaacttggattcatccacagagacatcaaaccagacaaccttcttttg
gacagcaagggccatgtgaaactttctgactttggtctttgcacaggactgaaaaaagca
cataggacagaattttataggaatctgaaccacagcctccccagtgatttcactttccag
aacatgaattccaaaaggaaagcagaaacctggaaaagaaatagacgtcagctagccttc
tccacagtaggcactcctgactacattgctcctgaggtgttcatgcagaccgggtacaac
aagctctgtgattggtggtcgcttggggtgatcatgtatgagatgctcatcggctaccca
cctttctgttctgagacccctcaagagacatataagaaggtgatgaactggaaagaaact
ttgacttttcctccagaagttcccatctctgagaaagccaaggatctaattttgaggttc
tgctgtgaatgggaacatagaattggagctcctggagttgaggaaataaaaagtaactct
ttttttgaaggcgttgactgggaacatatcagagagagacctgctgcaatatctattgaa
atcaaaagcattgatgatacctcaaacttcgatgagtttccagaatctgatattcttaag
ccaacagtggccacaagtaatcatcctgagactgactacaagaacaaagactgggtcttc
atcaattacacgtacaagcgctttgagggcctgactgcaaggggggcaataccttcctac
atgaaagcagcaaaatag

DBGET integrated database retrieval system