KEGG   Homo sapiens (human): 1133Help
Entry
1133              CDS       T01001                                 

Gene name
CHRM5, HM5
Definition
cholinergic receptor, muscarinic 5
Orthology
K04133  
muscarinic acetylcholine receptor M5
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Regulation of actin cytoskeleton
Drug target
Trimebutine: 
Piperidolate: 
Propantheline: 
Methantheline: 
Tridihexethyl: 
Isopropamide: 
Hexocyclium: 
Mepenzolate: 
Tiemonium iodide: 
Prifinium bromide: 
Timepidium bromide: 
Atropine: 
Hyoscyamine: 
Butylscopolamine: 
Methylatropine: 
Methylscopolamine: 
Fentonium: 
Cimetropium bromide: 
Scopolamine: 
Propiverine: 
Trospium: 
Fesoterodine: 
Orphenadrine (citrate): 
Trihexyphenidyl: 
Biperiden: 
Metixene: 
Procyclidine: 
Profenamine: 
Dexetimide: 
Mazaticol: 
Orphenadrine (chloride): 
Benzatropine: 
Etybenzatropine: 
Chlorpromazine: 
Carbachol: 
Bethanechol: 
Pilocarpine: 
Choline alfoscerate: 
Ipratropium bromide: 
Oxitropium bromide: 
Aclidinium bromide: 
Acetylcholine: 
Cyclopentolate: 
Homatropine: 
Tropicamide: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q26
AA seq 532 aa AA seqDB search
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPL
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAE
KRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQL
TTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPN
YLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP
NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggaaggggattcttaccacaatgcaaccaccgtcaatggcaccccagtaaatcaccag
cctttggaacgccacaggttgtgggaagtcatcaccattgcagctgtgactgctgtggta
agcctgatcaccattgtgggcaatgtcttggtcatgatctccttcaaagtcaacagccag
ctcaagacagttaacaactattacctgctcagcttagcctgtgcagatctcatcattgga
atcttctccatgaacctctacaccacctacatcctcatgggacgctgggctctcgggagt
ctggcttgtgacctttggcttgcactggactacgtggccagcaacgcttctgtcatgaac
cttctggtgatcagttttgaccgttacttttccatcacaagacccttgacatatcgggcc
aagcgtactccgaaaagggctggcatcatgattggcttggcctggctgatctccttcatc
ctctgggccccagcaatcctctgctggcagtacttggttgggaagcggacagttccactg
gatgagtgccagatccagtttctctctgagcccaccatcacttttggcactgccattgct
gccttctacatccctgtttctgtcatgaccatcctctactgtcgaatctaccgggaaaca
gagaagcgaaccaaggacctggctgacctccagggttctgactctgtgaccaaagctgag
aagagaaagccagctcatagggctctgttcagatcctgcttgcgctgtcctcgacccacc
ctggcccagcgggaaaggaaccaggcctcctggtcatcctcccgcaggagcacctccacc
actgggaagccatcccaagccactggcccaagcgccaattgggccaaagctgagcagctc
accacctgtagcagctacccttcctcagaggatgaggacaagcccgccactgaccctgtc
ctccaagtggtctacaagagtcagggtaaggaaagcccaggggaagaattcagtgctgaa
gagactgaggaaacttttgtgaaagctgaaactgaaaaaagtgactatgacaccccaaac
taccttctgtctccagcagctgctcatagacccaagagtcagaaatgtgtggcctataag
ttccgattggtggtaaaagctgacgggaaccaggagaccaacaatggctgtcacaaggtg
aaaatcatgccctgccccttcccagtggccaaggaaccttcaacgaaaggcctcaatccc
aaccccagccatcaaatgaccaaacgaaagagagtggtcctagtcaaagagaggaaagca
gcccagacactgagtgccattctcctggccttcatcatcacatggaccccgtataacatc
atggtcctggtttctaccttctgtgacaagtgtgtcccagtcaccctgtggcacttgggc
tattggttgtgctatgtcaatagcactgtcaaccccatctgctatgccctctgcaacaga
accttcaggaagacctttaagatgctgcttctctgccgatggaaaaagaaaaaagtggaa
gagaagttgtactggcaggggaacagcaagctaccctga

DBGET integrated database retrieval system