KEGG   Homo sapiens (human): 1133Help
Entry
1133              CDS       T01001                                 

Gene name
CHRM5, HM5
Definition
(RefSeq) cholinergic receptor muscarinic 5
  KO
K04133  
muscarinic acetylcholine receptor M5
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Regulation of actin cytoskeleton
Drug target
Acetylcholine (DG01133): 
Aclatonium (DG01291): 
Aclidinium bromide: 
Anisotropine methylbromide: 
Atropine (DG00052): 
Atropine oxide (DG01243): 
Batefenterol (DG01627): 
Benapryzine hydrochloride: 
Benzatropine (DG00859): 
Benzetimide (DG01301): 
Benzilone: 
Bethanechol (DG00991): 
Bevonium: 
Biperiden (DG00852): 
Butropium bromide: 
Butylscopolamine: 
Carbachol: 
Carpronium (DG01289): 
Chlorpromazine (DG00867): 
Choline alfoscerate: 
Cimetropium bromide: 
Clidinium bromide: 
Cyclopentolate (DG01141): 
Darotropium bromide: 
Dexetimide (DG00856): 
Diethazine (DG01921): 
Difemerine: 
Dihexyverine (DG00033): 
Diphemanil: 
Diphenylpiperidinomethyldioxolan iodide: 
Diponium bromide: 
Elantrine: 
Elucaine: 
Etomidoline: 
Etybenzatropine: 
Eucatropine hydrochloride: 
Fenpiverinium: 
Fentonium: 
Fesoterodine (DG00483): 
Flutropium bromide: 
Heteronium bromide: 
Hexocyclium (DG00039): 
Homatropine (DG01142): 
Hyoscine methobromide: 
Hyoscyamine (DG00053): 
Ipratropium bromide: 
Isopropamide (DG00038): 
Mazaticol (DG00857): 
Mebeverine (DG00030): 
Mepenzolate (DG00040): 
Methacholine (DG01290): 
Methantheline (DG00036): 
Methylatropine (DG01242): 
Methylbenactyzium bromide: 
Methylscopolamine: 
Metixene (DG00853): 
Metoquizine: 
Milameline hydrochloride: 
Orphenadrine (DG01252): 
Orphenadrine (chloride): 
Orphenadrine (citrate): 
Otilonium bromide: 
Oxapium iodide: 
Oxitropium bromide: 
Parapenzolate bromide: 
Pentapiperium methylsulfate: 
Penthienate: 
Phencarbamide: 
Phenglutarimide: 
Pilocarpine (DG00992): 
Pipenzolate: 
Piperidolate (DG00034): 
Pipethanate (DG01255): 
Pipethanate ethobromide: 
Piroheptine (DG01272): 
Poldine: 
Pridinol (DG00774): 
Prifinium bromide: 
Procyclidine (DG00854): 
Profenamine (DG00855): 
Propantheline (DG00035): 
Propenzolate hydrochloride: 
Propiverine (DG00479): 
Sabcomeline hydrochloride: 
Scopolamine (DG00065): 
Tazomeline citrate: 
Tematropium methylsulfate: 
Temiverine hydrochloride hydrate: 
Tiemonium (DG01254): 
Tiemonium iodide: 
Timepidium bromide (DG00041): 
Tofenacin hydrochloride: 
Toquizine: 
Triampyzine sulfate: 
Tridihexethyl (DG00037): 
Trihexyphenidyl (DG00851): 
Trimebutine (DG00031): 
Tropatepine (DG00858): 
Tropicamide: 
Trospium: 
Umeclidinium (DG01253): 
Umeclidinium bromide: 
Valethamate: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    1133 (CHRM5)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1133 (CHRM5)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    1133 (CHRM5)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    1133 (CHRM5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    1133 (CHRM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q26
AA seq 532 aa AA seqDB search
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPL
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAE
KRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQL
TTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPN
YLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP
NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggaaggggattcttaccacaatgcaaccaccgtcaatggcaccccagtaaatcaccag
cctttggaacgccacaggttgtgggaagtcatcaccattgcagctgtgactgctgtggta
agcctgatcaccattgtgggcaatgtcttggtcatgatctccttcaaagtcaacagccag
ctcaagacagttaacaactattacctgctcagcttagcctgtgcagatctcatcattgga
atcttctccatgaacctctacaccacctacatcctcatgggacgctgggctctcgggagt
ctggcttgtgacctttggcttgcactggactacgtggccagcaacgcttctgtcatgaac
cttctggtgatcagttttgaccgttacttttccatcacaagacccttgacatatcgggcc
aagcgtactccgaaaagggctggcatcatgattggcttggcctggctgatctccttcatc
ctctgggccccagcaatcctctgctggcagtacttggttgggaagcggacagttccactg
gatgagtgccagatccagtttctctctgagcccaccatcacttttggcactgccattgct
gccttctacatccctgtttctgtcatgaccatcctctactgtcgaatctaccgggaaaca
gagaagcgaaccaaggacctggctgacctccagggttctgactctgtgaccaaagctgag
aagagaaagccagctcatagggctctgttcagatcctgcttgcgctgtcctcgacccacc
ctggcccagcgggaaaggaaccaggcctcctggtcatcctcccgcaggagcacctccacc
actgggaagccatcccaagccactggcccaagcgccaattgggccaaagctgagcagctc
accacctgtagcagctacccttcctcagaggatgaggacaagcccgccactgaccctgtc
ctccaagtggtctacaagagtcagggtaaggaaagcccaggggaagaattcagtgctgaa
gagactgaggaaacttttgtgaaagctgaaactgaaaaaagtgactatgacaccccaaac
taccttctgtctccagcagctgctcatagacccaagagtcagaaatgtgtggcctataag
ttccgattggtggtaaaagctgacgggaaccaggagaccaacaatggctgtcacaaggtg
aaaatcatgccctgccccttcccagtggccaaggaaccttcaacgaaaggcctcaatccc
aaccccagccatcaaatgaccaaacgaaagagagtggtcctagtcaaagagaggaaagca
gcccagacactgagtgccattctcctggccttcatcatcacatggaccccgtataacatc
atggtcctggtttctaccttctgtgacaagtgtgtcccagtcaccctgtggcacttgggc
tattggttgtgctatgtcaatagcactgtcaaccccatctgctatgccctctgcaacaga
accttcaggaagacctttaagatgctgcttctctgccgatggaaaaagaaaaaagtggaa
gagaagttgtactggcaggggaacagcaagctaccctga

DBGET integrated database retrieval system