KEGG   Homo sapiens (human): 11337Help
Entry
11337             CDS       T01001                                 

Gene name
GABARAP, ATG8A, GABARAP-a, MM46
Definition
(RefSeq) GABA type A receptor-associated protein
  KO
K08341  
GABA(A) receptor-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Regulation of autophagy
GABAergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    11337 (GABARAP)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    11337 (GABARAP)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    11337 (GABARAP)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   11337 (GABARAP)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    11337 (GABARAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.1
AA seq 117 aa AA seqDB search
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgtgtacaaagaagagcatccgttcgagaagcgccgctctgagggcgagaag
atccgaaagaaatacccggaccgggtgccggtgatagtagaaaaggctcccaaagctcgg
ataggagacctggacaaaaagaaatacctggtgccttctgatctcacagttggtcagttc
tacttcttgatccggaagcgaattcatctccgagctgaggatgccttgtttttctttgtc
aacaatgtcattccacccaccagtgccacaatgggtcagctgtaccaggaacaccatgaa
gaagacttctttctctacattgcctacagtgacgaaagtgtctacggtctgtga

DBGET integrated database retrieval system