KEGG   Homo sapiens (human): 11337Help
Entry
11337             CDS       T01001                                 

Gene name
GABARAP, ATG8A, GABARAP-a, MM46
Definition
(RefSeq) GABA type A receptor-associated protein
  KO
K08341  
GABA(A) receptor-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Autophagy
NOD-like receptor signaling pathway
GABAergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    11337 (GABARAP)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy
    11337 (GABARAP)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    11337 (GABARAP)
  Nervous system
   04727 GABAergic synapse
    11337 (GABARAP)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   11337 (GABARAP)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    11337 (GABARAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.1
AA seq 117 aa AA seqDB search
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgtgtacaaagaagagcatccgttcgagaagcgccgctctgagggcgagaag
atccgaaagaaatacccggaccgggtgccggtgatagtagaaaaggctcccaaagctcgg
ataggagacctggacaaaaagaaatacctggtgccttctgatctcacagttggtcagttc
tacttcttgatccggaagcgaattcatctccgagctgaggatgccttgtttttctttgtc
aacaatgtcattccacccaccagtgccacaatgggtcagctgtaccaggaacaccatgaa
gaagacttctttctctacattgcctacagtgacgaaagtgtctacggtctgtga

DBGET integrated database retrieval system