KEGG   Homo sapiens (human): 11343Help
Entry
11343             CDS       T01001                                 

Gene name
MGLL, HU-K5, HUK5, MAGL, MGL
Definition
(RefSeq) monoglyceride lipase (EC:3.1.1.23)
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Metabolic pathways
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    11343 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    11343 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    11343 (MGLL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     11343 (MGLL)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S33
   11343 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q21.3
AA seq 303 aa AA seqDB search
MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEE
LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLG
HSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPID
SSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADR
LCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTA
SPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaaagttcccccaggcggaccccgcagagcattccctaccaggacctccct
cacctggtcaatgcagacggacagtacctcttctgcaggtactggaaacccacaggcaca
cccaaggccctcatctttgtgtcccatggagccggagagcacagtggccgctatgaagag
ctggctcggatgctgatggggctggacctgctggtgttcgcccacgaccatgttggccac
ggacagagcgaaggggagaggatggtagtgtctgacttccacgttttcgtcagggatgtg
ttgcagcatgtggattccatgcagaaagactaccctgggcttcctgtcttccttctgggc
cactccatgggaggcgccatcgccatcctcacggccgcagagaggccgggccacttcgcc
ggcatggtactcatttcgcctctggttcttgccaatcctgaatctgcaacaactttcaag
gtccttgctgcgaaagtgctcaaccttgtgctgccaaacttgtccctcgggcccatcgac
tccagcgtgctctctcggaataagacagaggtcgacatttataactcagaccccctgatc
tgccgggcagggctgaaggtgtgcttcggcatccaactgctgaatgccgtctcacgggtg
gagcgcgccctccccaagctgactgtgcccttcctgctgctccagggctctgccgatcgc
ctatgtgacagcaaaggggcctacctgctcatggagttagccaagagccaggacaagact
ctcaagatttatgaaggtgcctaccatgttctccacaaggagcttcctgaagtcaccaac
tccgtcttccatgaaataaacatgtgggtctctcaaaggacagccacggcaggaactgcg
tccccaccctga

DBGET integrated database retrieval system