KEGG   Homo sapiens (human): 113457Help
Entry
113457            CDS       T01001                                 

Gene name
TUBA3D, H2-ALPHA
Definition
tubulin, alpha 3d
Orthology
K07374  
tubulin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    113457 (TUBA3D)
  Cell communication
   04540 Gap junction
    113457 (TUBA3D)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    113457 (TUBA3D)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113457 (TUBA3D)
  Exosomal proteins of other body fluids (saliva and urine)
   113457 (TUBA3D)
  Exosomal proteins of colorectal cancer cells
   113457 (TUBA3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q21.1
AA seq 450 aa AA seqDB search
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLD
RIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGVDSVEAEAEEGEEY
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagtgtatctctatccacgtggggcaggcgggtgtccagatcggcaatgcctgc
tgggaactgtactgccttgaacatggaattcagcccgatggccaaatgccaagtgataaa
accattggtggcggggacgactccttcaacacgttcttcagtgagactggagctggcaag
cacgtgcccagagcagtgtttgtggacctggagcccactgtggtcgatgaagtgcgcaca
gggacctacaggcagctcttccacccggagcagctgatcaccgggaaggaagatgcagcc
aataattacgccaggggccattacaccatcggcaaggagattgttgacctagtcctggac
cggatccgcaaactggcggatctgtgcacaggactgcagggcttcctcatcttccacagc
tttgggggcggcactggctctgggttcgcatctctgctcatggagcggctctcagtggat
tacggcaagaagtccaagctagagtttgccatttacccagccccccaggtctccacagcc
gtggtggagccctacaactccatcctgaccacccacacgaccctggaacattctgactgt
gccttcatggtcgacaatgaagccatctatgacatatgtcggcgcaacctggacattgaa
cgtcccacgtacaccaacctcaatcgcctgattgggcagatcgtgtcctccatcacagcc
tccctgcgatttgatggggccctgaatgtggacttgacggaattccagaccaacctagtg
ccgtacccccgcatccacttccccctggccacctatgccccagtcatctcagctgagaag
gcctaccacgagcagctgtctgtggccgagatcaccaatgcctgcttcgagccagccaat
caaatggtcaagtgtgaccctcgccacggcaagtacatggcctgctgcatgttgtacagg
ggggacgtggtccccaaagacgtcaacgcggccatcgccaccatcaagaccaagcgcacc
atccagtttgtggattggtgcccgactggatttaaggtgggcattaactaccagcccccc
acagtggtccccgggggagacctggccaaggtgcagcgggccgtgtgcatgctgagcaac
accacggccattgcggaggcctgggcccgcctggaccataagttcgatctcatgtatgcc
aagcgggcctttgtgcactggtacgtgggcgaaggcatggaagagggagagttctctgag
gcccgcgaggacctggcagctctagagaaggattatgaagaggtgggcgtggattccgtg
gaagctgaggctgaagaaggcgaagaatactga

  All links  
No link information was found.   
DBGET integrated database retrieval system