KEGG   Homo sapiens (human): 113457Help
Entry
113457            CDS       T01001                                 

Gene name
TUBA3D, H2-ALPHA
Definition
tubulin, alpha 3d
Orthology
K07374  
tubulin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q21.1
AA seq 450 aa AA seqDB search
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLD
RIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGVDSVEAEAEEGEEY
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagtgtatctctatccacgtggggcaggcgggtgtccagatcggcaatgcctgc
tgggaactgtactgccttgaacatggaattcagcccgatggccaaatgccaagtgataaa
accattggtggcggggacgactccttcaacacgttcttcagtgagactggagctggcaag
cacgtgcccagagcagtgtttgtggacctggagcccactgtggtcgatgaagtgcgcaca
gggacctacaggcagctcttccacccggagcagctgatcaccgggaaggaagatgcagcc
aataattacgccaggggccattacaccatcggcaaggagattgttgacctagtcctggac
cggatccgcaaactggcggatctgtgcacaggactgcagggcttcctcatcttccacagc
tttgggggcggcactggctctgggttcgcatctctgctcatggagcggctctcagtggat
tacggcaagaagtccaagctagagtttgccatttacccagccccccaggtctccacagcc
gtggtggagccctacaactccatcctgaccacccacacgaccctggaacattctgactgt
gccttcatggtcgacaatgaagccatctatgacatatgtcggcgcaacctggacattgaa
cgtcccacgtacaccaacctcaatcgcctgattgggcagatcgtgtcctccatcacagcc
tccctgcgatttgatggggccctgaatgtggacttgacggaattccagaccaacctagtg
ccgtacccccgcatccacttccccctggccacctatgccccagtcatctcagctgagaag
gcctaccacgagcagctgtctgtggccgagatcaccaatgcctgcttcgagccagccaat
caaatggtcaagtgtgaccctcgccacggcaagtacatggcctgctgcatgttgtacagg
ggggacgtggtccccaaagacgtcaacgcggccatcgccaccatcaagaccaagcgcacc
atccagtttgtggattggtgcccgactggatttaaggtgggcattaactaccagcccccc
acagtggtccccgggggagacctggccaaggtgcagcgggccgtgtgcatgctgagcaac
accacggccattgcggaggcctgggcccgcctggaccataagttcgatctcatgtatgcc
aagcgggcctttgtgcactggtacgtgggcgaaggcatggaagagggagagttctctgag
gcccgcgaggacctggcagctctagagaaggattatgaagaggtgggcgtggattccgtg
gaagctgaggctgaagaaggcgaagaatactga

DBGET integrated database retrieval system