KEGG   Homo sapiens (human): 1135Help
Entry
1135              CDS       T01001                                 

Gene name
CHRNA2
Definition
cholinergic receptor, nicotinic, alpha 2 (neuronal)
Orthology
K04804  
nicotinic acetylcholine receptor alpha-2
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Disease
H00807  
Autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE)
Drug target
Mecamylamine: 
Acetylcholine: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p21
AA seq 529 aa AA seqDB search
MGPSCPVFLSFTKLSLWWLLLTPAGGEEAKRPPPRAPGDPLSSPSPTALPQGGSHTETED
RLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKL
RWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYK
SSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTY
NSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLC
ISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTH
TMPHWVRGALLGCVPRWLLMNRPPPPVELCHPLRLKLSPSYHWLESNVDAEEREVVVEEE
DRWACAGHVAPSVGTLCSHGHLHSGASGPKAEALLQEGELLLSPHMQKALEGVHYIADHL
RSEDADSSVKEDWKYVAMVIDRIFLWLFIIVCFLGTIGLFLPPFLAGMI
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgggcccctcctgtcctgtgttcctgtccttcacaaagctcagcctgtggtggctcctt
ctgaccccagcaggtggagaggaagctaagcgcccacctcccagggctcctggagaccca
ctctcctctcccagtcccacggcattgccgcagggaggctcgcataccgagactgaggac
cggctcttcaaacacctcttccggggctacaaccgctgggcgcgcccggtgcccaacact
tcagacgtggtgattgtgcgctttggactgtccatcgctcagctcatcgatgtggatgag
aagaaccaaatgatgaccaccaacgtctggctaaaacaggagtggagcgactacaaactg
cgctggaaccccactgattttggcaacatcacatctctcagggtcccttctgagatgatc
tggatccccgacattgttctctacaacaatgcagatggggagtttgcagtgacccacatg
accaaggcccacctcttctccacgggcactgtgcactgggtgcccccggccatctacaag
agctcctgcagcatcgacgtcaccttcttccccttcgaccagcagaactgcaagatgaag
tttggctcctggacttatgacaaggccaagatcgacctggagcagatggagcagactgtg
gacctgaaggactactgggagagcggcgagtgggccatcgtcaatgccacgggcacctac
aacagcaagaagtacgactgctgcgccgagatctaccccgacgtcacctacgccttcgtc
atccggcggctgccgctcttctacaccatcaacctcatcatcccctgcctgctcatctcc
tgcctcactgtgctggtcttctacctgccctccgactgcggcgagaagatcacgctgtgc
atttcggtgctgctgtcactcaccgtcttcctgctgctcatcactgagatcatcccgtcc
acctcgctggtcatcccgctcatcggcgagtacctgctgttcaccatgatcttcgtcacc
ctgtccatcgtcatcaccgtcttcgtgctcaatgtgcaccaccgctcccccagcacccac
accatgccccactgggtgcggggggcccttctgggctgtgtgccccggtggcttctgatg
aaccggcccccaccacccgtggagctctgccaccccctacgcctgaagctcagcccctct
tatcactggctggagagcaacgtggatgccgaggagagggaggtggtggtggaggaggag
gacagatgggcatgtgcaggtcatgtggccccctctgtgggcaccctctgcagccacggc
cacctgcactctggggcctcaggtcccaaggctgaggctctgctgcaggagggtgagctg
ctgctatcaccccacatgcagaaggcactggaaggtgtgcactacattgccgaccacctg
cggtctgaggatgctgactcttcggtgaaggaggactggaagtatgttgccatggtcatc
gacaggatcttcctctggctgtttatcatcgtctgcttcctggggaccatcggcctcttt
ctgcctccgttcctagctggaatgatctga

DBGET integrated database retrieval system