KEGG   Homo sapiens (human): 113540Help
Entry
113540            CDS       T01001                                 

Gene name
CMTM1, CKLFH, CKLFH1, CKLFSF1
Definition
(RefSeq) CKLF like MARVEL transmembrane domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q21
AA seq 169 aa AA seqDB search
MDPEHAKPESSEAPSGNLKQPETAAALSLILGALACFIITQANESFITITSLEICIVVFF
ILIYVLTLHHLLTYLHWPLLDLTNSIITAVFLSVVAILAMQEKKRRHLLYVGGSLCLTAV
IVCCIDAFVVTTKMRTNLKRFLGVEVERKLSPAKDAYPETGPDAPQRPA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgaacacgccaaacctgagtcatccgaggcaccttcagggaacttgaaacaa
ccggagactgccgcagccctgagtcttatcttaggagcattagcttgtttcatcatcacc
caagccaatgagtcatttataacaatcacaagtctggaaatctgcattgtcgtttttttt
attctaatatatgtgctaacccttcaccacttgctgacctatttacattggcccttactt
gatcttaccaacagtatcattacagctgtgttcctttcagtagttgccatcttggccatg
caagaaaagaaaagaaggcatttactctatgtcggggggtccctgtgtctcacagcggta
atcgtgtgttgcatcgatgcgtttgtggtcaccacgaagatgaggaccaacttgaaaaga
ttcctgggagtcgaagttgaaaggaagctttcccccgccaaggacgcctaccccgaaacc
ggccccgacgccccgcagaggcccgcctga

DBGET integrated database retrieval system