KEGG   Homo sapiens (human): 1136Help
Entry
1136              CDS       T01001                                 

Gene name
CHRNA3, LNCR2, NACHRA3, PAOD2
Definition
cholinergic receptor, nicotinic, alpha 3 (neuronal)
Orthology
K04805  
nicotinic acetylcholine receptor alpha-3
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Drug target
Trimetaphan: 
Mecamylamine: 
Acetylcholine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1136 (CHRNA3)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    1136 (CHRNA3)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Acetylcholine (nicotinic)
   1136 (CHRNA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q24
AA seq 505 aa AA seqDB search
MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPV
IIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPD
IVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSW
SYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
PLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLV
IPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPT
SNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLT
RSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFL
WVFTLVCILGTAGLFLQPLMAREDA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggctctggcccgctctcgctgcccctggcgctgtcgccgccgcggctgctgctgctg
ctgctgctgtctctgctgccagtggccagggcctcagaggctgagcaccgtctatttgag
cggctgtttgaagattacaatgagatcatccggcctgtagccaacgtgtctgacccagtc
atcatccatttcgaggtgtccatgtctcagctggtgaaggtggatgaagtaaaccagatc
atggagaccaacctgtggctcaagcaaatctggaatgactacaagctgaaatggaacccc
tctgactatggtggggcagagttcatgcgtgtccctgcacagaagatctggaagccagac
attgtgctgtataacaatgctgttggggatttccaggtggacgacaagaccaaagcctta
ctcaagtacactggggaggtgacttggatacctccggccatctttaagagctcctgtaaa
atcgacgtgacctacttcccgtttgattaccaaaactgtaccatgaagttcggttcctgg
tcctacgataaggcgaaaatcgatctggtcctgatcggctcttccatgaacctcaaggac
tattgggagagcggcgagtgggccatcatcaaagccccaggctacaaacacgacatcaag
tacaactgctgcgaggagatctaccccgacatcacatactcgctgtacatccggcgcctg
cccttgttctacaccatcaacctcatcatcccctgcctgctcatctccttcctcactgtg
ctcgtcttctacctgccctccgactgcggtgagaaggtgaccctgtgcatttctgtcctc
ctctccctgacggtgtttctcctggtgatcactgagaccatcccttccacctcgctggtc
atccccctgattggagagtacctcctgttcaccatgatttttgtaaccttgtccatcgtc
atcaccgtcttcgtgctcaacgtgcactacagaaccccgacgacacacacaatgccctca
tgggtgaagactgtattcttgaacctgctccccagggtcatgttcatgaccaggccaaca
agcaacgagggcaacgctcagaagccgaggcccctctacggtgccgagctctcaaatctg
aattgcttcagccgcgcagagtccaaaggctgcaaggagggctacccctgccaggacggg
atgtgtggttactgccaccaccgcaggataaaaatctccaatttcagtgctaacctcacg
agaagctctagttctgaatctgttgatgctgtgctgtccctctctgctttgtcaccagaa
atcaaagaagccatccaaagtgtcaagtatattgctgaaaatatgaaagcacaaaatgaa
gccaaagagattcaagatgattggaagtatgttgccatggtgattgatcgtatttttctg
tgggttttcaccctggtgtgcattctagggacagcaggattgtttctgcaacccctgatg
gccagggaagatgcataa

DBGET integrated database retrieval system