KEGG   Homo sapiens (human): 1136Help
Entry
1136              CDS       T01001                                 

Gene name
CHRNA3, LNCR2, NACHRA3, PAOD2
Definition
cholinergic receptor, nicotinic, alpha 3 (neuronal)
Orthology
K04805  
nicotinic acetylcholine receptor alpha-3
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Drug target
Mecamylamine: 
Acetylcholine: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q24
AA seq 505 aa AA seqDB search
MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPV
IIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPD
IVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSW
SYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
PLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLV
IPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPT
SNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLT
RSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFL
WVFTLVCILGTAGLFLQPLMAREDA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggctctggcccgctctcgctgcccctggcgctgtcgccgccgcggctgctgctgctg
ctgctgctgtctctgctgccagtggccagggcctcagaggctgagcaccgtctatttgag
cggctgtttgaagattacaatgagatcatccggcctgtagccaacgtgtctgacccagtc
atcatccatttcgaggtgtccatgtctcagctggtgaaggtggatgaagtaaaccagatc
atggagaccaacctgtggctcaagcaaatctggaatgactacaagctgaaatggaacccc
tctgactatggtggggcagagttcatgcgtgtccctgcacagaagatctggaagccagac
attgtgctgtataacaatgctgttggggatttccaggtggacgacaagaccaaagcctta
ctcaagtacactggggaggtgacttggatacctccggccatctttaagagctcctgtaaa
atcgacgtgacctacttcccgtttgattaccaaaactgtaccatgaagttcggttcctgg
tcctacgataaggcgaaaatcgatctggtcctgatcggctcttccatgaacctcaaggac
tattgggagagcggcgagtgggccatcatcaaagccccaggctacaaacacgacatcaag
tacaactgctgcgaggagatctaccccgacatcacatactcgctgtacatccggcgcctg
cccttgttctacaccatcaacctcatcatcccctgcctgctcatctccttcctcactgtg
ctcgtcttctacctgccctccgactgcggtgagaaggtgaccctgtgcatttctgtcctc
ctctccctgacggtgtttctcctggtgatcactgagaccatcccttccacctcgctggtc
atccccctgattggagagtacctcctgttcaccatgatttttgtaaccttgtccatcgtc
atcaccgtcttcgtgctcaacgtgcactacagaaccccgacgacacacacaatgccctca
tgggtgaagactgtattcttgaacctgctccccagggtcatgttcatgaccaggccaaca
agcaacgagggcaacgctcagaagccgaggcccctctacggtgccgagctctcaaatctg
aattgcttcagccgcgcagagtccaaaggctgcaaggagggctacccctgccaggacggg
atgtgtggttactgccaccaccgcaggataaaaatctccaatttcagtgctaacctcacg
agaagctctagttctgaatctgttgatgctgtgctgtccctctctgctttgtcaccagaa
atcaaagaagccatccaaagtgtcaagtatattgctgaaaatatgaaagcacaaaatgaa
gccaaagagattcaagatgattggaagtatgttgccatggtgattgatcgtatttttctg
tgggttttcaccctggtgtgcattctagggacagcaggattgtttctgcaacccctgatg
gccagggaagatgcataa

DBGET integrated database retrieval system