KEGG   Homo sapiens (human): 113612Help
Entry
113612            CDS       T01001                                 

Gene name
CYP2U1, P450TEC, SPG49, SPG56
Definition
cytochrome P450, family 2, subfamily U, polypeptide 1 (EC:1.14.14.1)
Orthology
K07422  
cytochrome P450, family 2, subfamily U, polypeptide 1
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hsa00590]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q25
AA seq 544 aa AA seqDB search
MSSPGPSQPPAEDPPWPARLLRAPLGLLRLDPSGGALLLCGLVALLGWSWLRRRRARGIP
PGPTPWPLVGNFGHVLLPPFLRRRSWLSSRTRAAGIDPSVIGPQVLLAHLARVYGSIFSF
FIGHYLVVVLSDFHSVREALVQQAEVFSDRPRVPLISIVTKEKGVVFAHYGPVWRQQRKF
SHSTLRHFGLGKLSLEPKIIEEFKYVKAEMQKHGEDPFCPFSIISNAVSNIICSLCFGQR
FDYTNSEFKKMLGFMSRGLEICLNSQVLLVNICPWLYYLPFGPFKELRQIEKDITSFLKK
IIKDHQESLDRENPQDFIDMYLLHMEEERKNNSNSSFDEEYLFYIIGDLFIAGTDTTTNS
LLWCLLYMSLNPDVQEKVHEEIERVIGANRAPSLTDKAQMPYTEATIMEVQRLTVVVPLA
IPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLDDQGQLIKKETF
IPFGIGKRVCMGEQLAKMELFLMFVSLMQSFAFALPEDSKKPLLTGRFGLTLAPHPFNIT
ISRR
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctccggggccgtcgcagccgccggccgaggacccgccctggcccgcgcgcctc
ctgcgtgcgcctctggggctgctgcggctggaccccagcgggggcgcgctgctgctatgc
ggcctcgtagcgctgctgggctggagctggctgcggaggcgccgggcgcggggcatcccg
cccgggcccacgccctggcctctggtgggcaacttcggtcacgtgctgctgcctcccttc
ctccggcggcggagctggctgagcagcaggaccagggccgcagggattgatccctcggtc
ataggcccgcaggtgctcctggctcacctagcccgcgtgtacggcagcatcttcagcttc
tttatcggccactacctggtggtggtcctcagcgacttccacagcgtgcgcgaggcgctg
gtgcagcaggccgaggtcttcagcgaccgcccgcgggtgccgctcatctccatcgtgacc
aaggagaagggggttgtgtttgcacattatggtcccgtctggagacaacaaaggaagttc
tctcattcaactcttcgtcattttgggttgggaaaacttagcttggagcccaagattatt
gaggagttcaaatatgtgaaagcagaaatgcaaaagcacggagaagaccccttctgccct
ttctccatcatcagcaatgccgtctctaacatcatttgctccttgtgctttggccagcgc
tttgattacactaatagtgagttcaagaaaatgcttggttttatgtcacgaggcctagaa
atctgtctgaacagtcaagtcctcctggtcaacatatgcccttggctttattaccttccc
tttggaccatttaaggaattaagacaaattgaaaaggatataaccagtttccttaaaaaa
atcatcaaagaccatcaagagtctctggatagagagaaccctcaggacttcatagacatg
taccttctccacatggaagaggagaggaaaaataatagtaacagcagttttgatgaagag
tacttattttatatcattggggatctctttattgctgggactgataccacaactaactct
ttgctctggtgcctgctgtatatgtcgctgaaccccgatgtacaagaaaaggttcatgaa
gaaattgaaagagtcattggcgccaaccgagctccttccctcacagacaaggcccagatg
ccctacacagaagccaccatcatggaagtgcagaggctaactgtggtggtgccgcttgcc
attcctcatatgacctcagagaacacagtgctccaagggtataccattcctaaaggcaca
ttgatcttacccaacctgtggtcagtacatagagacccagccatttgggagaaaccggag
gatttctaccctaatcgatttctggatgaccaaggacaactaattaaaaaagaaaccttt
attccttttgggatagggaagcgggtgtgtatgggagaacaactggcaaagatggaatta
ttcctaatgtttgtgagcctaatgcagagtttcgcatttgctttacctgaggattctaag
aagcccctcctgactggaagatttggtctaactttagccccacatccatttaatataact
atttcaaggagatga

DBGET integrated database retrieval system