KEGG   Homo sapiens (human): 1137Help
Entry
1137              CDS       T01001                                 

Gene name
CHRNA4, BFNC, EBN, EBN1, NACHR, NACHRA4, NACRA4
Definition
cholinergic receptor, nicotinic, alpha 4 (neuronal)
Orthology
K04806  
nicotinic acetylcholine receptor alpha-4
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Nicotine addiction
Disease
H00807  
Autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE)
Drug target
Trimetaphan: 
Mecamylamine: 
Varenicline: 
Acetylcholine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1137 (CHRNA4)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    1137 (CHRNA4)
 Human Diseases
  Substance dependence
   05033 Nicotine addiction
    1137 (CHRNA4)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Acetylcholine (nicotinic)
   1137 (CHRNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.33
AA seq 627 aa AA seqDB search
MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISD
VVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWR
PDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFG
SWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIR
RLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTS
LVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKR
PSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGP
SCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEG
GVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSV
SPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDR
IFLWMFIIVCLLGTVGLFLPPWLAGMI
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggagctagggggccccggagcgccgcggctgctgccgccgctgctgctgcttctgggg
accggcctcctgcgcgccagcagccatgtggagacccgggcccacgccgaggagcggctc
ctgaagaaactcttctccggttacaacaagtggtcccgacccgtggccaacatctcggac
gtggtcctcgtccgcttcggcctgtccatcgctcagctcattgacgtggatgagaagaac
cagatgatgaccacgaacgtatgggtgaagcaggagtggcacgactacaagctgcgctgg
gacccagctgactatgagaatgtcacctccatccgcatcccctccgagctcatctggcgg
ccggacatcgtcctctacaacaatgctgacggggacttcgcggtcacccacctgaccaag
gcccacctgttccatgacgggcgggtgcagtggactcccccggccatttacaagagctcc
tgcagcatcgacgtcaccttcttccccttcgaccagcagaactgcaccatgaaattcggc
tcctggacctacgacaaggccaagatcgacctggtgaacatgcacagccgcgtggaccag
ctggacttctgggagagtggcgagtgggtcatcgtggatgccgtgggcacctacaacacc
aggaagtacgagtgctgtgccgagatctacccggacatcacctatgccttcgtcatccgg
cggctgccgctcttctacaccatcaacctcatcatcccctgcctgctcatctcctgcctc
accgtgctggtcttctacctgccctccgagtgtggcgagaagatcacgctgtgcatctcc
gtgctgctgtcgctcaccgtcttcctgctgctcatcaccgagatcatcccgtccacctca
ctggtcatcccactcatcggcgagtacctgctgttcaccatgatcttcgtcaccctgtcc
atcgtcatcacggtcttcgtgctcaacgtgcaccaccgctcgccacgcacgcacaccatg
cccacctgggtacgcagggtcttcctggacatcgtgccacgcctgctcctcatgaagcgg
ccgtccgtggtcaaggacaattgccggcggctcatcgagtccatgcataagatggccagt
gccccgcgcttctggcccgagccagaaggggagccccctgccacgagcggcacccagagc
ctgcacccgccctcaccgtccttctgtgtccccctggatgtgccggctgagcctgggcct
tcctgcaagtcaccctccgaccagctccctcctcagcagcccctggaagctgagaaagcc
agcccccacccctcgcctggaccctgccgcccgccccacggcacccaggcaccagggctg
gccaaagccaggtccctcagcgtccagcacatgtccagccctggcgaagcggtggaaggc
ggcgtccggtgccggtctcggagcatccagtactgtgttccccgagacgatgccgccccc
gaggcagatggccaggctgccggcgccctggcctctcgcaacacccactcggctgagctc
ccacccccagaccagccctctccgtgcaaatgcacatgcaagaaggagccctcttcggtg
tccccgagcgccacggtcaagacccgcagcaccaaagcgccgcccccgcacctgcccctg
tcgccggccctgacccgggcggtggagggcgtccagtacattgcagaccacctgaaggcc
gaagacacagacttctcggtgaaggaggactggaagtacgtggccatggtcatcgaccgc
atcttcctctggatgttcatcatcgtctgcctgctggggacggtgggcctcttcctgccg
ccctggctggctggcatgatctag

DBGET integrated database retrieval system