KEGG   Homo sapiens (human): 1138Help
Entry
1138              CDS       T01001                                 

Gene name
CHRNA5, LNCR2
Definition
(RefSeq) cholinergic receptor nicotinic alpha 5 subunit
  KO
K04807  
nicotinic acetylcholine receptor alpha-5
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Trimetaphan [DG:DG00251]: 
Mecamylamine [DG:DG00252]: 
Acetylcholine [DG:DG01133]: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1138 (CHRNA5)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Acetylcholine (nicotinic)
   1138 (CHRNA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q24
AA seq 468 aa AA seqDB search
MAARGSGPRALRLLLLVQLVAGRCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYER
WVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKV
IRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD
LQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYV
TYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIE
EIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPLVRKIFLHTL
PKLLCMRSHVDRYFTQKEETESGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDW
KFIAQVLDRMFLWTFLFVSIVGSLGLFVPVIYKWANILIPVHIGNANK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcgggggtcagggccccgcgcgctccgcctgctgctcttggtccagctggtc
gcggggcgctgcggtctagcgggcgcggcgggcggcgcgcagagaggattatctgaacct
tcttctattgcaaaacatgaagatagtttgcttaaggatttatttcaagactacgaaaga
tgggttcgtcctgtggaacacctgaatgacaaaataaaaataaaatttggacttgcaata
tctcaattggtggatgtggatgagaaaaatcagttaatgacaacaaacgtctggttgaaa
caggaatggatagatgtaaaattaagatggaaccctgatgactatggtggaataaaagtt
atacgtgttccttcagactctgtctggacaccagacatcgttttgtttgataatgcagat
ggacgttttgaagggaccagtacgaaaacagtcatcaggtacaatggcactgtcacctgg
actccaccggcaaactacaaaagttcctgtaccatagatgtcacgtttttcccatttgac
cttcagaactgttccatgaaatttggttcttggacttatgatggatcacaggttgatata
attctagaggaccaagatgtagacaagagagatttttttgataatggagaatgggagatt
gtgagtgcaacagggagcaaaggaaacagaaccgacagctgttgctggtatccgtatgtc
acttactcatttgtaatcaagcgcctgcctctcttttataccttgttccttataataccc
tgtattgggctctcatttttaactgtacttgtcttctatcttccttcaaatgaaggtgaa
aagatttgtctctgcacttcagtacttgtgtctttgactgtcttccttctggttattgaa
gagatcataccatcatcttcaaaagtcatacctctaattggagagtatctggtatttacc
atgatttttgtgacactgtcaattatggtaaccgtcttcgctatcaacattcatcatcgt
tcttcctcaacacataatgccatggcgcctttggtccgcaagatatttcttcacacgctt
cccaaactgctttgcatgagaagtcatgtagacaggtacttcactcagaaagaggaaact
gagagtggtagtggaccaaaatcttctagaaacacattggaagctgcgctcgattctatt
cgctacattacaagacacatcatgaaggaaaatgatgtccgtgaggttgttgaagattgg
aaattcatagcccaggttcttgatcggatgtttctgtggacttttcttttcgtttcaatt
gttggatctcttgggctttttgttcctgttatttataaatgggcaaatatattaatacca
gttcatattggaaatgcaaataagtga

DBGET integrated database retrieval system