KEGG   Homo sapiens (human): 113878Help
Entry
113878            CDS       T01001                                 

Gene name
DTX2, RNF58
Definition
(RefSeq) deltex 2, E3 ubiquitin ligase
  KO
K06058  
deltex [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    113878 (DTX2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     113878 (DTX2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    113878 (DTX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q11.23
AA seq 622 aa AA seqDB search
MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLA
HSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGS
WTAYEASVCDYLEQQVARGNQLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPY
PVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGT
HQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLYRSSLSHLGPQHLPPGSSTSG
AVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPVCLSRAPQPTS
PPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLS
TASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKT
GTQPQGKMEVLRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLP
DNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPN
YLQNVLAELAAQGVTEDCLEQQ
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggccatggccccaagcccttccctggtgcaggtgtacaccagccccgcggctgtggcc
gtgtgggaatggcaggacgggctgggcacctggcacccctacagtgccaccgtctgcagc
ttcatcgagcagcagtttgtccagcagaagggccaacgttttgggcttgggagcctggcc
cacagcatccccttgggccaggcagacccctcgctggccccttacattattgacctcccc
agctggacccagttccgccaggacaccggcaccatgcgggctgtgcggagacacctgttc
ccccagcactcagcccctggccgaggtgtcgtctgggagtggctgagcgacgatggctcc
tggactgcctatgaagccagcgtctgtgactatctggagcagcaggtggccaggggcaac
cagctcgtggacttggcccccctggggtacaactacactgtcaactacaccacccacacg
cagaccaacaagacttccagcttctgccgcagcgtgcggcgccaagcagggccgccttac
ccggtgaccaccatcatcgctccgccgggccacacaggcgtcgcctgctcttgccaccag
tgcctcagtggcagcagaactggccccgtgtcaggccgctaccgccactccatgaccaac
ctccctgcataccccgtcccccagcaccccccacacaggaccgcttctgtgtttgggacc
caccaggcctttgcaccgtacaacaaaccctcactctccggggcccggtctgcgcccagg
ctgaacaccaccaacgcctggggcgcagctcctccttccctggggagccagcccctctac
cgctccagcctctcccacctgggaccgcagcacctgcccccaggatcctccacctccggt
gcagtcagtgcctccctccccagcggtccctcaagcagcccagggagcgtccctgccact
gtgcccatgcagatgccaaagcccagcagagtccagcaggcgctcgcaggcatgacgagt
gttctgatgtcagccattggactccctgtgtgtcttagccgcgcaccccagcccaccagc
cctcccgcctcccgtctggcttccaaaagtcacggctcagttaagagattgaggaaaatg
tccgtgaaaggagcgaccccgaagccagagccagagccagagcaggtcataaaaaactac
acggaagagctgaaagtgcccccagatgaggactgcatcatctgcatggagaagctgtcc
acagcgtctggatacagcgatgtgactgacagcaaggcaatcgggtccctagctgtgggc
cacctcaccaagtgcagccatgccttccacctgctgtgcctcctggccatgtactgcaac
ggcaataaggatggaagtctgcagtgtccctcctgcaaaaccatctatggagagaagacg
gggacccagccccagggaaagatggaggtattacggttccagatgtcgctccccggccac
gaggactgcgggaccatcctcatagtttacagcattccccatggtatccagggccctgag
caccccaatcccggaaagccgttcactgccagagggtttccccgccagtgctaccttcca
gacaacgcccagggccgcaaggtcctagagctcctgaaggtggcctggaagaggcggctc
atcttcacagtgggcacgtccagcaccacgggtgagacggacaccgtggtatggaacgag
atccaccacaagacagagatggaccgcaacattacgggccacggctatcccgaccccaac
tacctgcagaacgtgctggctgagctggctgcccagggggtgaccgaggactgcctggag
cagcagtga

DBGET integrated database retrieval system