KEGG   Homo sapiens (human): 113878Help
Entry
113878            CDS       T01001                                 

Gene name
DTX2, RNF58
Definition
deltex homolog 2 (Drosophila)
Orthology
K06058  
deltex
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q11.23
AA seq 622 aa AA seqDB search
MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLA
HSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGS
WTAYEASVCDYLEQQVARGNQLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPY
PVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGT
HQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLYRSSLSHLGPQHLPPGSSTSG
AVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPVCLSRAPQPTS
PPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLS
TASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKT
GTQPQGKMEVLRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLP
DNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPN
YLQNVLAELAAQGVTEDCLEQQ
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggccatggccccaagcccttccctggtgcaggtgtacaccagccccgcggctgtggcc
gtgtgggaatggcaggacgggctgggcacctggcacccctacagtgccaccgtctgcagc
ttcatcgagcagcagtttgtccagcagaagggccaacgttttgggcttgggagcctggcc
cacagcatccccttgggccaggcagacccctcgctggccccttacattattgacctcccc
agctggacccagttccgccaggacaccggcaccatgcgggctgtgcggagacacctgttc
ccccagcactcagcccctggccgaggtgtcgtctgggagtggctgagcgacgatggctcc
tggactgcctatgaagccagcgtctgtgactatctggagcagcaggtggccaggggcaac
cagctcgtggacttggcccccctggggtacaactacactgtcaactacaccacccacacg
cagaccaacaagacttccagcttctgccgcagcgtgcggcgccaagcagggccgccttac
ccggtgaccaccatcatcgctccgccgggccacacaggcgtcgcctgctcttgccaccag
tgcctcagtggcagcagaactggccccgtgtcaggccgctaccgccactccatgaccaac
ctccctgcataccccgtcccccagcaccccccacacaggaccgcttctgtgtttgggacc
caccaggcctttgcaccgtacaacaaaccctcactctccggggcccggtctgcgcccagg
ctgaacaccaccaacgcctggggcgcagctcctccttccctggggagccagcccctctac
cgctccagcctctcccacctgggaccgcagcacctgcccccaggatcctccacctccggt
gcagtcagtgcctccctccccagcggtccctcaagcagcccagggagcgtccctgccact
gtgcccatgcagatgccaaagcccagcagagtccagcaggcgctcgcaggcatgacgagt
gttctgatgtcagccattggactccctgtgtgtcttagccgcgcaccccagcccaccagc
cctcccgcctcccgtctggcttccaaaagtcacggctcagttaagagattgaggaaaatg
tccgtgaaaggagcgaccccgaagccagagccagagccagagcaggtcataaaaaactac
acggaagagctgaaagtgcccccagatgaggactgcatcatctgcatggagaagctgtcc
acagcgtctggatacagcgatgtgactgacagcaaggcaatcgggtccctagctgtgggc
cacctcaccaagtgcagccatgccttccacctgctgtgcctcctggccatgtactgcaac
ggcaataaggatggaagtctgcagtgtccctcctgcaaaaccatctatggagagaagacg
gggacccagccccagggaaagatggaggtattacggttccagatgtcgctccccggccac
gaggactgcgggaccatcctcatagtttacagcattccccatggtatccagggccctgag
caccccaatcccggaaagccgttcactgccagagggtttccccgccagtgctaccttcca
gacaacgcccagggccgcaaggtcctagagctcctgaaggtggcctggaagaggcggctc
atcttcacagtgggcacgtccagcaccacgggtgagacggacaccgtggtatggaacgag
atccaccacaagacagagatggaccgcaacattacgggccacggctatcccgaccccaac
tacctgcagaacgtgctggctgagctggctgcccagggggtgaccgaggactgcctggag
cagcagtga

DBGET integrated database retrieval system