KEGG   Homo sapiens (human): 113878Help
Entry
113878            CDS       T01001                                 

Gene name
DTX2, RNF58
Definition
deltex 2, E3 ubiquitin ligase
Orthology
K06058  
deltex
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    113878 (DTX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q11.23
AA seq 622 aa AA seqDB search
MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLA
HSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGS
WTAYEASVCDYLEQQVARGNQLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPY
PVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGT
HQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLYRSSLSHLGPQHLPPGSSTSG
AVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPVCLSRAPQPTS
PPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLS
TASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKT
GTQPQGKMEVLRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLP
DNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPN
YLQNVLAELAAQGVTEDCLEQQ
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggccatggccccaagcccttccctggtgcaggtgtacaccagccccgcggctgtggcc
gtgtgggaatggcaggacgggctgggcacctggcacccctacagtgccaccgtctgcagc
ttcatcgagcagcagtttgtccagcagaagggccaacgttttgggcttgggagcctggcc
cacagcatccccttgggccaggcagacccctcgctggccccttacattattgacctcccc
agctggacccagttccgccaggacaccggcaccatgcgggctgtgcggagacacctgttc
ccccagcactcagcccctggccgaggtgtcgtctgggagtggctgagcgacgatggctcc
tggactgcctatgaagccagcgtctgtgactatctggagcagcaggtggccaggggcaac
cagctcgtggacttggcccccctggggtacaactacactgtcaactacaccacccacacg
cagaccaacaagacttccagcttctgccgcagcgtgcggcgccaagcagggccgccttac
ccggtgaccaccatcatcgctccgccgggccacacaggcgtcgcctgctcttgccaccag
tgcctcagtggcagcagaactggccccgtgtcaggccgctaccgccactccatgaccaac
ctccctgcataccccgtcccccagcaccccccacacaggaccgcttctgtgtttgggacc
caccaggcctttgcaccgtacaacaaaccctcactctccggggcccggtctgcgcccagg
ctgaacaccaccaacgcctggggcgcagctcctccttccctggggagccagcccctctac
cgctccagcctctcccacctgggaccgcagcacctgcccccaggatcctccacctccggt
gcagtcagtgcctccctccccagcggtccctcaagcagcccagggagcgtccctgccact
gtgcccatgcagatgccaaagcccagcagagtccagcaggcgctcgcaggcatgacgagt
gttctgatgtcagccattggactccctgtgtgtcttagccgcgcaccccagcccaccagc
cctcccgcctcccgtctggcttccaaaagtcacggctcagttaagagattgaggaaaatg
tccgtgaaaggagcgaccccgaagccagagccagagccagagcaggtcataaaaaactac
acggaagagctgaaagtgcccccagatgaggactgcatcatctgcatggagaagctgtcc
acagcgtctggatacagcgatgtgactgacagcaaggcaatcgggtccctagctgtgggc
cacctcaccaagtgcagccatgccttccacctgctgtgcctcctggccatgtactgcaac
ggcaataaggatggaagtctgcagtgtccctcctgcaaaaccatctatggagagaagacg
gggacccagccccagggaaagatggaggtattacggttccagatgtcgctccccggccac
gaggactgcgggaccatcctcatagtttacagcattccccatggtatccagggccctgag
caccccaatcccggaaagccgttcactgccagagggtttccccgccagtgctaccttcca
gacaacgcccagggccgcaaggtcctagagctcctgaaggtggcctggaagaggcggctc
atcttcacagtgggcacgtccagcaccacgggtgagacggacaccgtggtatggaacgag
atccaccacaagacagagatggaccgcaacattacgggccacggctatcccgaccccaac
tacctgcagaacgtgctggctgagctggctgcccagggggtgaccgaggactgcctggag
cagcagtga

DBGET integrated database retrieval system