KEGG   Homo sapiens (human): 1140Help
Entry
1140              CDS       T01001                                 

Gene name
CHRNB1, ACHRB, CHRNB, CMS1D, CMS2A, CMS2C, SCCMS
Definition
(RefSeq) cholinergic receptor nicotinic beta 1 subunit
  KO
K04812  
nicotinic acetylcholine receptor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Disease
H00770  
Congenital myasthenic syndrome
Drug target
Trimetaphan [DG:DG00251]: 
Mecamylamine [DG:DG00252]: 
Tubocurarine [DG:DG00767]: 
Dimethyltubocurarine: 
Suxamethonium [DG:DG00768]: 
Pancuronium [DG:DG00769]: 
Gallamine: 
Vecuronium [DG:DG00770]: 
Atracurium [DG:DG00771]: 
Pipecuronium bromide: 
Doxacurium chloride: 
Fazadinium bromide: 
Rocuronium bromide: 
Mivacurium chloride: 
Cisatracurium: 
Acetylcholine [DG:DG01133]: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1140 (CHRNB1)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Acetylcholine (nicotinic)
   1140 (CHRNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 501 aa AA seqDB search
MTPGALLMLLGALGAPLAPGVRGSEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLIL
AQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNND
GNFDVALDISVVVSSDGSVRWQPPGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVS
LQTGLGPDGQGHQEIHIHEGTFIENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLI
IRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPE
TSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRL
KRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFI
DGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTS
VGTLVIFLDATYHLPPPDPFP
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaggggctctgctgatgctgctgggggcgctgggggcgccgctcgccccaggc
gtccgcggctcggaggcggagggtcgactccgggagaaacttttctctggctatgatagc
tccgtgcggccagcgcgggaggtgggagaccgtgtcagggtcagcgttggtctcatcctg
gcgcaactcatcagcctgaacgagaaggatgaagagatgagcacaaaggtgtacttagac
ctggagtggactgactacaggctgagctgggaccctgcggagcacgacggcatcgattcg
ctccgcatcacggcggaatccgtgtggctccctgacgtggtgctactgaacaacaatgat
gggaattttgacgtggctctggacattagcgtcgtggtgtcctccgacggctccgtgcgt
tggcaacccccgggcatctatcgcagcagctgcagcatccaggtcacctacttccccttc
gactggcagaattgcactatggtgttcagctcctacagctacgacagctcggaggtcagc
ctgcagacaggcctgggtcctgacgggcaagggcatcaggaaatccacattcatgaaggg
actttcattgagaatggccagtgggagattatccacaagccctctcggctaatccagcct
ccaggcgatcctaggggagggagggaaggacagcgccaggaagtcatcttctacctcatc
atccgccgcaagcctctcttctacctggtcaacgtcattgccccatgcatcctcatcact
cttctggccatcttcgtcttctacctgccaccagatgcaggagagaagatggggctctca
atctttgccctgctgacccttactgtgttcctgctgctgctggctgacaaagtacctgag
acctcactatcagtacccattattatcaagtacctcatgtttaccatggtcctcgtcacc
ttctcagtcatccttagtgtcgtggttctcaacctgcaccaccgctcaccccacacccac
caaatgcccctttgggtccgtcagatcttcattcacaaacttccgctgtacctgcgtcta
aaaaggcccaaacccgagagagacctgatgccggagccccctcactgttcttctccagga
agtggctggggtcggggaacagatgaatatttcatccggaagccgccaagtgattttctc
ttccccaaacccaataggttccagcctgaactgtctgcccctgatctgcggcgatttatc
gatggtccaaaccgggctgtggccctgcttccggagctacgggaggtcgtctcctctatc
agctacatcgctcgacagctgcaggaacaggaggaccacgatgcgctgaaggaggactgg
cagtttgtggccatggtagtggaccgcctcttcctgtggactttcatcatcttcaccagc
gttgggaccctagtcatcttcctggacgccacgtaccacttgccccctccagaccccttt
ccttga

DBGET integrated database retrieval system