KEGG   Homo sapiens (human): 1140Help
Entry
1140              CDS       T01001                                 

Gene name
CHRNB1, ACHRB, CHRNB, CMS1D, CMS2A, SCCMS
Definition
cholinergic receptor, nicotinic, beta 1 (muscle)
Orthology
K04812  
nicotinic acetylcholine receptor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Disease
H00770  
Congenital myasthenic syndrome
Drug target
Mecamylamine: 
Tubocurarine: 
Dimethyltubocurarine: 
Suxamethonium: 
Pancuronium: 
Gallamine: 
Vecuronium: 
Atracurium: 
Pipecuronium bromide: 
Doxacurium chloride: 
Rocuronium bromide: 
Mivacurium chloride: 
Cisatracurium: 
Acetylcholine: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 501 aa AA seqDB search
MTPGALLMLLGALGAPLAPGVRGSEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLIL
AQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNND
GNFDVALDISVVVSSDGSVRWQPPGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVS
LQTGLGPDGQGHQEIHIHEGTFIENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLI
IRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPE
TSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRL
KRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFI
DGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTS
VGTLVIFLDATYHLPPPDPFP
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaggggctctgctgatgctgctgggggcgctgggggcgccgctcgccccaggc
gtccgcggctcggaggcggagggtcgactccgggagaaacttttctctggctatgatagc
tccgtgcggccagcgcgggaggtgggagaccgtgtcagggtcagcgttggtctcatcctg
gcgcaactcatcagcctgaacgagaaggatgaagagatgagcacaaaggtgtacttagac
ctggagtggactgactacaggctgagctgggaccctgcggagcacgacggcatcgattcg
ctccgcatcacggcggaatccgtgtggctccctgacgtggtgctactgaacaacaatgat
gggaattttgacgtggctctggacattagcgtcgtggtgtcctccgacggctccgtgcgt
tggcaacccccgggcatctatcgcagcagctgcagcatccaggtcacctacttccccttc
gactggcagaattgcactatggtgttcagctcctacagctacgacagctcggaggtcagc
ctgcagacaggcctgggtcctgacgggcaagggcatcaggaaatccacattcatgaaggg
actttcattgagaatggccagtgggagattatccacaagccctctcggctaatccagcct
ccaggcgatcctaggggagggagggaaggacagcgccaggaagtcatcttctacctcatc
atccgccgcaagcctctcttctacctggtcaacgtcattgccccatgcatcctcatcact
cttctggccatcttcgtcttctacctgccaccagatgcaggagagaagatggggctctca
atctttgccctgctgacccttactgtgttcctgctgctgctggctgacaaagtacctgag
acctcactatcagtacccattattatcaagtacctcatgtttaccatggtcctcgtcacc
ttctcagtcatccttagtgtcgtggttctcaacctgcaccaccgctcaccccacacccac
caaatgcccctttgggtccgtcagatcttcattcacaaacttccgctgtacctgcgtcta
aaaaggcccaaacccgagagagacctgatgccggagccccctcactgttcttctccagga
agtggctggggtcggggaacagatgaatatttcatccggaagccgccaagtgattttctc
ttccccaaacccaataggttccagcctgaactgtctgcccctgatctgcggcgatttatc
gatggtccaaaccgggctgtggccctgcttccggagctacgggaggtcgtctcctctatc
agctacatcgctcgacagctgcaggaacaggaggaccacgatgcgctgaaggaggactgg
cagtttgtggccatggtagtggaccgcctcttcctgtggactttcatcatcttcaccagc
gttgggaccctagtcatcttcctggacgccacgtaccacttgccccctccagaccccttt
ccttga

DBGET integrated database retrieval system