KEGG   Homo sapiens (human): 1141Help
Entry
1141              CDS       T01001                                 

Gene name
CHRNB2, EFNL3, nAChRB2
Definition
(RefSeq) cholinergic receptor nicotinic beta 2 subunit
  KO
K04813  nicotinic acetylcholine receptor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
Disease
H00807  Autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE)
Drug target
Acetylcholine (DG01133): D00999
Altinicline maleate: D02839
Dexmecamylamine (DG01378): D10111 D10112
Hexamethonium bromide: D02204
Ispronicline: D08935
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Pozanicline (DG01288): D09367 D09368
Rivanicline galactarate: D08987
Sofinicline (DG01286): D09382 D09383
Tebanicline tosylate: D06016
Varenicline (DG00995): D06282 D08669
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1141 (CHRNB2)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    1141 (CHRNB2)
 Human Diseases
  Substance dependence
   05033 Nicotine addiction
    1141 (CHRNB2)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Acetylcholine (nicotinic)
   1141 (CHRNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Motif
Other DBs
NCBI-GeneID: 1141
NCBI-ProteinID: NP_000739
OMIM: 118507
HGNC: 1962
Ensembl: ENSG00000160716
Vega: OTTHUMG00000037262
Pharos: P17787(Tclin)
UniProt: P17787 Q5SXY3
Structure
PDB: 

Jmol
Position
1q21.3
AA seq 502 aa AA seqDB search
MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL
MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLY
NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR
TEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTIN
LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQR
LRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC
GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ
PLFQNYTTTTFLHSDHSAPSSK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcccggcgctgcggccccgtggcgctgctccttggcttcggcctcctccggctgtgc
tcaggggtgtggggtacggatacagaggagcggctggtggagcatctcctggatccttcc
cgctacaacaagcttatccgcccagccaccaatggctctgagctggtgacagtacagctt
atggtgtcactggcccagctcatcagtgtgcatgagcgggagcagatcatgaccaccaat
gtctggctgacccaggagtgggaagattatcgcctcacctggaagcctgaagagtttgac
aacatgaagaaagttcggctcccttccaaacacatctggctcccagatgtggtcctgtac
aacaatgctgacggcatgtacgaggtgtccttctattccaatgccgtggtctcctatgat
ggcagcatcttctggctgccgcctgccatctacaagagcgcatgcaagattgaagtaaag
cacttcccatttgaccagcagaactgcaccatgaagttccgttcgtggacctacgaccgc
acagagatcgacttggtgctgaagagtgaggtggccagcctggacgacttcacacctagt
ggtgagtgggacatcgtggcgctgccgggccggcgcaacgagaaccccgacgactctacg
tacgtggacatcacgtatgacttcatcattcgccgcaagccgctcttctacaccatcaac
ctcatcatcccctgtgtgctcatcacctcgctagccatccttgtcttctacctgccatcc
gactgtggcgagaagatgacgttgtgcatctcagtgctgctggcgctcacggtcttcctg
ctgctcatctccaagatcgtgcctcccacctccctcgacgtgccgctcgtcggcaagtac
ctcatgttcaccatggtgcttgtcaccttctccatcgtcaccagcgtgtgcgtgctcaac
gtgcaccaccgctcgcccaccacgcacaccatggcgccctgggtgaaggtcgtcttcctg
gagaagctgcccgcgctgctcttcatgcagcagccacgccatcattgcgcccgtcagcgc
ctgcgcctgcggcgacgccagcgtgagcgcgagggcgctggagccctcttcttccgcgaa
gccccaggggccgactcctgcacgtgcttcgtcaaccgcgcgtcggtgcaggggttggcc
ggggccttcggggctgagcctgcaccagtggcgggccccgggcgctcaggggagccgtgt
ggctgtggcctccgggaggcggtggacggcgtgcgcttcatcgcagaccacatgcggagc
gaggacgatgaccagagcgtgagtgaggactggaagtacgtcgccatggtgatcgaccgc
ctcttcctctggatctttgtctttgtctgtgtctttggcaccatcggcatgttcctgcag
cctctcttccagaactacaccaccaccaccttcctccactcagaccactcagcccccagc
tccaagtga

DBGET integrated database retrieval system