KEGG   Homo sapiens (human): 114112Help
Entry
114112            CDS       T01001                                 

Gene name
TXNRD3, TGR, TR2, TRXR3
Definition
thioredoxin reductase 3 (EC:1.8.1.9)
Orthology
K00384  
thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    114112 (TXNRD3)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    114112 (TXNRD3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     114112 (TXNRD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q21.3
AA seq 607 aa AA seqDB search
MERSPPQSPGPGKAGDAPNRRSGHVRGARVLSPPGRRARLSSPGPSRSSEAREELRRHLV
GLIERSRVVIFSKSYCPHSTRVKELFSSLGVECNVLELDQVDDGARVQEVLSEITNQKTV
PNIFVNKVHVGGCDQTFQAYQSGLLQKLLQEDLAYDYDLIIIGGGSGGLSCAKEAAILGK
KVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGQALCDSRKFGWEYNQQVRH
NWETMTKAIQNHISSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQ
FVIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGFGLDV
TVMVRSILLRGFDQEMAEKVGSYMEQHGVKFLRKFIPVMVQQLEKGSPGKLKVLAKSTEG
TETIEGVYNTVLLAIGRDSCTRKIGLEKIGVKINEKSGKIPVNDVEQTNVPYVYAVGDIL
EDKPELTPVAIQSGKLLAQRLFGASLEKIYHTLFWPLEWTVAGRENNTCYAKIICNKFDH
DRVIGFHILGPNAGEVTQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTLEITKSSGLDI
TQKGCUG
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
ctggagcggtcgccgccgcagtcgcccgggccgggaaaggcgggcgatgcccccaaccgc
cgctcgggccatgtccgaggggcgcgcgtgttgtcgccgccggggcgccgtgcccgcctg
tcgtcccccgggcccagccgctcgtccgaggcccgcgaggagctgcgccgccacctcgtg
ggcctcatcgagcgcagccgggtggtgatcttcagcaagagctactgtccccatagtact
cgggtgaaagaactcttttcttctttgggagtcgaatgtaatgtcttggaacttgatcaa
gttgatgatggggccagggttcaagaagtgctgtcagaaatcactaatcagaaaactgtg
cccaatattttcgtgaataaagtgcatgtaggtggatgtgaccaaactttccaggcatat
cagagtggtttgttacagaagctccttcaggaagatttggcatatgattatgatctcatc
atcatcggtggtggttctggaggcctttcatgtgcgaaggaagctgccattttgggaaag
aaagttatggtgctagactttgttgtcccgtcacctcagggcacatcctggggtcttggt
ggcacttgtgtaaatgtaggttgtattcctaagaaattgatgcatcaggctgcccttttg
gggcaggcattatgtgactcaaggaaatttggctgggaatataatcaacaagtgaggcac
aactgggagacaatgacaaaagcgattcagaaccacatcagctctctaaactggggctac
aggttgtctctgagggaaaaggctgtggcctatgtcaattcctatggagaatttgttgaa
catcataaaataaaggcaaccaataaaaaaggacaggagacttattatactgctgcacag
tttgtcatagcaacgggtgaaaggccacggtatttaggaatccaaggagataaagaatac
tgtattactagtgatgaccttttttctctgccttattgccctggcaaaacattagtggtg
ggtgcctcttatgttgccctggagtgtgcagggtttctggctggctttggcctagatgtc
acagttatggtacgctcaatccttctccgtggcttcgaccaagaaatggcagaaaaagtg
ggttcctacatggagcagcatggtgtgaagttcctacggaaattcatacctgtgatggtt
caacagttggagaaaggttcacctggaaagctgaaagtgttggctaaatccactgaagga
acagaaacaattgaaggagtctataacacagttttgttagctattggtcgtgactcctgt
acaaggaaaataggcttggagaagattggtgtcaaaattaatgagaagagtggaaaaata
cctgtaaatgatgtggaacagaccaatgtgccatatgtctatgctgttggtgatattttg
gaggataagccagagctcactcctgtcgccatacagtcaggcaagctgctagctcagaga
ctttttggggcctctttagaaaagatatatcatactttgttctggcctcttgaatggaca
gtagctggcagagagaacaacacttgttacgcaaagataatctgcaataaattcgaccat
gatcgggtgataggatttcatattcttggaccaaacgccggtgaggttacccaaggattt
gcagctgcaatgaaatgtgggctcacaaaacagctacttgatgacaccattggaattcac
cccacatgtggggaggtgttcacgactttggaaatcacaaagtcgtcaggactagacatc
actcagaaaggctgctgaggctag

DBGET integrated database retrieval system