KEGG   Homo sapiens (human): 1142Help
Entry
1142              CDS       T01001                                 

Gene name
CHRNB3
Definition
(RefSeq) cholinergic receptor nicotinic beta 3 subunit
  KO
K04814  
nicotinic acetylcholine receptor beta-3
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Trimetaphan [DG:DG00251]: 
Mecamylamine [DG:DG00252]: 
Acetylcholine [DG:DG01133]: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1142 (CHRNB3)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Acetylcholine (nicotinic)
   1142 (CHRNB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p11.2
AA seq 458 aa AA seqDB search
MLPDFMLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGL
KISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFEN
ADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTM
VDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLPLFYTLFL
IIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYL
LFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMKDHVDRYSSPE
KEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWK
FVAQVLDRIFLWLFLIVSVTGSVLIFTPALKMWLHSYH
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgctcccagattttatgctggttctcatcgtccttggcatcccttcctcagccaccaca
ggtttcaactcaatcgccgaaaatgaagatgccctcctcagacatttgttccaaggttat
cagaaatgggtccgccctgtattacattctaatgacaccataaaagtatattttggattg
aaaatatcccagcttgtagatgtggatgaaaagaatcagctgatgacaaccaatgtgtgg
ctcaaacaggaatggacagaccacaagttacgctggaatcctgatgattatggtgggatc
cattccattaaagttccatcagaatctctgtggcttcctgacatagttctctttgaaaat
gctgacggccgcttcgaaggctccctgatgaccaaggtcatcgtgaaatcaaacggaact
gttgtctggacccctcccgccagctacaaaagctcctgcaccatggacgtcacgtttttc
ccgttcgaccgacagaactgctccatgaagtttggatcctggacttatgatggcaccatg
gttgacctcattttgatcaatgaaaatgtcgacagaaaagacttcttcgataacggagaa
tgggaaatactgaacgcaaaggggatgaaggggaacagaagggacggcgtgtactcctat
ccctttatcacgtattccttcgtcctgagacgcctgcctttattctataccctctttctc
atcatcccctgcctggggctgtctttcctaacagttcttgtgttctatttaccttcggat
gaaggagaaaaactttcattatccacatcggtcttggtttctctgacagttttcctttta
gtgattgaagaaatcatcccatcgtcttccaaagtcattcctctcattggagagtacctg
ctgttcatcatgatttttgtgaccctgtccatcattgttaccgtgtttgtcattaacgtt
caccacagatcttcttccacgtaccaccccatggccccctgggttaagaggctctttctg
cagaaacttccaaaattactttgcatgaaagatcatgtggatcgctactcatccccagag
aaagaggagagtcaaccagtagtgaaaggcaaagtcctcgaaaaaaagaaacagaaacag
cttagtgatggagaaaaagttctagttgcttttttggaaaaagctgctgattccattaga
tacatttcgagacatgtgaagaaagaacattttatcagccaggtagtacaagactggaaa
tttgtagctcaagttcttgaccgaatcttcctgtggctctttctgatagtgtcagtaaca
ggctcggttctgatttttacccctgctttgaagatgtggctacatagttaccattag

DBGET integrated database retrieval system