KEGG   Homo sapiens (human): 1143Help
Entry
1143              CDS       T01001                                 

Gene name
CHRNB4
Definition
cholinergic receptor, nicotinic, beta 4 (neuronal)
Orthology
K04815  
nicotinic acetylcholine receptor beta-4
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Drug target
Mecamylamine: 
Acetylcholine: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q24
AA seq 498 aa AA seqDB search
MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQL
SLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNN
ADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTE
IDMVLMTPTASMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLI
IPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLM
FTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRPGPDSSPARAF
PPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRF
RQDVQEALEGVSFIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLP
PLFQTHAASEGPYAAQRD
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgcgcgccttccctggtccttttcttcctggtcgccctttgcgggcgcgggaac
tgccgcgtggccaatgcggaggaaaagctgatggacgaccttctgaacaaaacccgttac
aataacctgatccgcccagccaccagctcctcacagctcatctccatcaagctgcagctc
tccctggcccagcttatcagcgtgaatgagcgagagcagatcatgaccaccaatgtctgg
ctgaaacaggaatggactgattaccgcctgacctggaacagctcccgctacgagggtgtg
aacatcctgaggatccctgcaaagcgcatctggttgcctgacatcgtgctttacaacaac
gccgacgggacctatgaggtgtctgtctacaccaacttgatagtccggtccaacggcagc
gtcctgtggctgccccctgccatctacaagagcgcctgcaagattgaggtgaagtacttt
cccttcgaccagcagaactgcaccctcaagttccgctcctggacctatgaccacacggag
atagacatggtcctcatgacgcccacagccagcatggatgactttactcccagtggtgag
tgggacatagtggccctcccagggagaaggacagtgaacccacaagaccccagctacgtg
gacgtgacttacgacttcatcatcaagcgcaagcctctgttctacaccatcaacctcatc
atcccctgcgtgctcaccaccttgctggccatcctcgtcttctacctgccatccgactgc
ggcgagaagatgacactgtgcatctcagtgctgctggcactgacattcttcctgctgctc
atctccaagatcgtgccacccacctccctcgatgtgcctctcatcggcaagtacctcatg
ttcaccatggtgctggtcaccttctccatcgtcaccagcgtctgtgtgctcaatgtgcac
caccgctcgcccagcacccacaccatggcaccctgggtcaagcgctgcttcctgcacaag
ctgcctaccttcctcttcatgaagcgccctggccccgacagcagcccggccagagccttc
ccgcccagcaagtcatgcgtgaccaagcccgaggccaccgccacctccaccagcccctcc
aacttctatgggaactccatgtactttgtgaaccccgcctctgcagcttccaagtctcca
gccggctctaccccggtggctatccccagggatttctggctgcggtcctctgggaggttc
cgacaggatgtgcaggaggcattagaaggtgtcagcttcatcgcccagcacatgaagaat
gacgatgaagaccagagtgtcgttgaggactggaagtacgtggctatggtggtggaccgg
ctgttcctgtgggtgttcatgtttgtgtgcgtcctgggcactgtggggctcttcctaccg
cccctcttccagacccatgcagcttctgaggggccctacgctgcccagcgtgactga

DBGET integrated database retrieval system