KEGG   Homo sapiens (human): 1144Help
Entry
1144              CDS       T01001                                 

Gene name
CHRND, ACHRD, CMS2A, CMS3A, CMS3B, CMS3C, FCCMS, SCCMS
Definition
(RefSeq) cholinergic receptor nicotinic delta subunit
  KO
K04816  
nicotinic acetylcholine receptor delta
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Disease
H00770  
Congenital myasthenic syndrome
H00986  
Multiple pterygium syndrome
Drug target
Acetylcholine (DG01133): 
Atracurium (DG00771): 
Cisatracurium: 
Dimethyltubocurarine: 
Doxacurium chloride: 
Fazadinium bromide: 
Gallamine: 
Gantacurium chloride: 
Lobeline (DG01287): 
Mecamylamine (DG00252): 
Mivacurium chloride: 
Pancuronium (DG00769): 
Pipecuronium bromide: 
Rapacuronium bromide: 
Rocuronium bromide: 
Suxamethonium (DG00768): 
Trimetaphan (DG00251): 
Tubocurarine (DG00767): 
Vecuronium (DG00770): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1144 (CHRND)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Acetylcholine (nicotinic)
   1144 (CHRND)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37.1
AA seq 517 aa AA seqDB search
MEGPVLTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTL
SNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNND
GSFQISYSCNVLVYHYGFVYWLPPAIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEIT
LSLKQDAKENRTYPVEWIIIDPEGFTENGEWEIVHRPARVNVDPRAPLDSPSRQDITFYL
IIRRKPLFYIINILVPCVLISFMVNLVFYLPADSGEKTSVAISVLLAQSVFLLLISKRLP
ATSMAIPLIGKFLLFGMVLVTMVVVICVIVLNIHFRTPSTHVLSEGVKKLFLETLPELLH
MSRPAEDGPSPGALVRRSSSLGYISKAEEYFLLKSRSDLMFEKQSERHGLARRLTTARRP
PASSEQAQQELFNELKPAVDGANFIVNHMRDQNNYNEEKDSWNRVARTVDRLCLFVVTPV
MVVGTAWIFLQGVYNQPPPQPFPGDPYSYNVQDKRFI
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggaggggccagtgctgacactggggctgctggctgccctggcggtgtgtggcagctgg
gggctgaacgaggaggagcggctgatccggcacctgtttcaagagaagggctacaacaag
gagctccggcccgtggcacacaaagaggagagtgtggacgttgccctggccctcacactc
tccaacctcatctccctgaaagaagttgaggagaccctcactaccaatgtgtggatagag
cacggctggacagacaaccggctgaagtggaatgctgaagaatttggaaacatcagtgtc
ctgcgcctccccccggacatggtgtggctcccagagattgtgctggagaacaacaatgac
ggctccttccagatctcctactcctgcaacgtgcttgtctaccactacggcttcgtgtac
tggctgccacctgccatcttccgctcctcctgccccatctctgtcacctatttccccttc
gactggcagaactgctccctcaagttcagttccctcaagtatacggccaaagagatcacc
ctgagcctgaaacaggatgccaaggagaaccgcacctaccccgtggagtggatcatcatt
gatcctgaaggcttcacagagaacggggagtgggagatagtccaccggccggccagggtc
aacgtggaccccagagcccctctggacagccccagccgccaggacatcaccttctacctc
atcatccgccgcaagcccctcttctacatcatcaacatcctggtgccctgcgtgctcatc
tccttcatggtcaacctggtcttctacctaccggctgacagtggtgagaagacatcagtg
gccatctcggtgctcctggctcagtctgtcttcctgctgctcatctccaagcgtctgcct
gccacatccatggccatcccccttatcggcaagttcctgctcttcggcatggtgctggtc
accatggttgtggtgatctgtgtcatcgtgctcaacatccacttccgaacacccagcacc
catgtgctgtctgagggggtcaagaagctcttcctggagaccctgccggagctcctgcac
atgtcccgcccagcagaggatggacccagccctggggccctggtgcggaggagcagctcc
ctgggatacatctccaaggccgaggagtacttcctgctcaagtcccgcagtgacctcatg
ttcgagaagcagtcagagcggcatgggctggccaggcgcctcaccactgcacgccggccc
ccagcaagctctgagcaggcccagcaggaactcttcaatgagctgaagccagctgtggat
ggggcaaacttcattgttaaccacatgagggaccagaacaattacaatgaggagaaagac
agctggaaccgagtggcccgcacagtggaccgcctctgcctgtttgtggtgacgcctgtc
atggtggtgggcacagcctggatcttcctgcagggcgtttacaaccagccaccaccccag
ccttttcctggggacccctactcctacaacgtgcaggacaagcgcttcatctag

DBGET integrated database retrieval system