KEGG   Homo sapiens (human): 1146Help
Entry
1146              CDS       T01001                                 

Gene name
CHRNG, ACHRG
Definition
(RefSeq) cholinergic receptor nicotinic gamma subunit
  KO
K04818  nicotinic acetylcholine receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00986  Multiple pterygium syndrome
Drug target
Acetylcholine (DG01133): D00999
Atracurium (DG00771): D00758
Cisatracurium: D00759
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Gallamine: D02292
Gantacurium chloride: D04303
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Mivacurium chloride: D00763
Pancuronium (DG00769): D00492
Pipecuronium bromide: D00764
Rapacuronium bromide: D05703
Rocuronium bromide: D00765
Suxamethonium (DG00768): D00766 D02275
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1146 (CHRNG)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Acetylcholine (nicotinic)
   1146 (CHRNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 1146
NCBI-ProteinID: NP_005190
OMIM: 100730
HGNC: 1967
Ensembl: ENSG00000196811
Vega: OTTHUMG00000153327
Pharos: P07510(Tclin)
UniProt: P07510
Position
2q37.1
AA seq 517 aa AA seqDB search
MHGGQGPLLLLLLLAVCLGAQGRNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLT
NLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDG
VFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDL
QLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRK
PLFYVINIIAPCVLISSVAILIHFLPAKAGGQKCTVAINVLLAQTVFLFLVAKKVPETSQ
AVPLISKYLTFLLVVTILIVVNAVVVLNVSLRSPHTHSMARGVRKVFLRLLPQLLRMHVR
PLAPAAVQDTQSRLQNGSSGWSITTGEEVALCLPRSELLFQQWQRQGLVAAALEKLEKGP
ELGLSQFCGSLKQAAPAIQACVEACNLIACARHQQSHFDNGNEEWFLVGRVLDRVCFLAM
LSLFICGTAGIFLMAHYNRVPALPFPGDPRPYLPSPD
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcatgggggccaggggccgctgctcctcctgctgctgctggctgtctgcctgggggcc
cagggccggaaccaggaggagcgcctgctcgcagacctgatgcaaaactacgaccccaac
ctgcggcccgcggaacgagactcggatgtggtcaatgtcagcctgaagctaaccctcacc
aacctcatctccctgaacgagcgagaggaagccctcaccaccaatgtctggatagagatg
cagtggtgcgactatcgcctgcgctgggatccgcgagactacgaaggcctgtgggtgctg
agggtgccgtccaccatggtgtggcggccggatatcgtgctggagaacaacgtggacggt
gtcttcgaggtggccctctactgcaatgtgctcgtgtcccctgacggctgtatctactgg
ctgccgcctgccatcttccgttccgcctgctctatctcagtcacctacttccccttcgac
tggcagaactgctcccttatcttccagtcccagacttacagcaccaatgagattgatctg
cagctgagtcaggaagatggccagaccatcgagtggattttcattgaccctgaggccttc
acagagaatggggagtgggccatccagcaccgaccagccaagatgctcctggacccagcg
gcgccagcccaggaagcaggccaccagaaggtggtgttctacctgctcatccagcgcaag
cccctcttctacgtcatcaacatcatcgccccctgtgtgctcatctcctctgtcgccatc
ctcatccacttccttcctgccaaggctgggggccagaagtgtaccgtcgccatcaacgtg
ctcctggcccagactgtcttcctcttccttgtggccaagaaggtgcctgaaacctcccag
gcggtgccactcatcagcaagtacctgaccttcctcctggtggtgaccatcctcattgtc
gtgaatgctgtggttgtgctcaatgtctccttgcggtctccacacacacactccatggcc
cgaggggtccgcaaggtgttcctgaggctcttgccccagctgctgaggatgcacgttcgc
ccgctggccccggcagctgtgcaggacacccagtcccggctacagaatggctcctcggga
tggtcgatcacaactggggaggaggtggccctctgcctgcctcgcagtgaactcctcttc
cagcagtggcagcggcaagggctggtggcggcagcgctggagaagctagagaaaggcccg
gagttagggctgagccagttctgtggcagcctgaagcaggctgccccagccatccaggcc
tgtgtggaagcctgcaacctcattgcctgtgcccggcaccagcagagtcactttgacaat
gggaatgaggagtggttcctggtgggccgagtgctggaccgcgtctgcttcctggccatg
ctctcgctcttcatctgtggcacagctggcatcttcctcatggcccactacaaccgggtg
ccggccctgccattccctggagatccacgcccctacctgccctcaccagactga

DBGET integrated database retrieval system