KEGG   Homo sapiens (human): 1147Help
Entry
1147              CDS       T01001                                 

Gene name
CHUK, IKBKA, IKK-alpha, IKK1, IKKA, NFKBIKA, TCF16
Definition
(RefSeq) conserved helix-loop-helix ubiquitous kinase
  KO
K04467  
inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
hsa  Homo sapiens (human)
Pathway
Antifolate resistance
MAPK signaling pathway
Ras signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
IL-17 signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Hepatitis C
Hepatitis B
Measles
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Pancreatic cancer
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Fluid shear stress and atherosclerosis
Module
Toll-like receptor signaling
Disease
H00882  
Cocoon syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    1147 (CHUK)
   04010 MAPK signaling pathway
    1147 (CHUK)
   04064 NF-kappa B signaling pathway
    1147 (CHUK)
   04668 TNF signaling pathway
    1147 (CHUK)
   04068 FoxO signaling pathway
    1147 (CHUK)
   04151 PI3K-Akt signaling pathway
    1147 (CHUK)
   04150 mTOR signaling pathway
    1147 (CHUK)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    1147 (CHUK)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    1147 (CHUK)
   04621 NOD-like receptor signaling pathway
    1147 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    1147 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    1147 (CHUK)
   04660 T cell receptor signaling pathway
    1147 (CHUK)
   04658 Th1 and Th2 cell differentiation
    1147 (CHUK)
   04659 Th17 cell differentiation
    1147 (CHUK)
   04657 IL-17 signaling pathway
    1147 (CHUK)
   04662 B cell receptor signaling pathway
    1147 (CHUK)
   04062 Chemokine signaling pathway
    1147 (CHUK)
  Endocrine system
   04920 Adipocytokine signaling pathway
    1147 (CHUK)
  Development
   04380 Osteoclast differentiation
    1147 (CHUK)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1147 (CHUK)
   05212 Pancreatic cancer
    1147 (CHUK)
   05221 Acute myeloid leukemia
    1147 (CHUK)
   05220 Chronic myeloid leukemia
    1147 (CHUK)
   05215 Prostate cancer
    1147 (CHUK)
   05222 Small cell lung cancer
    1147 (CHUK)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    1147 (CHUK)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    1147 (CHUK)
   05131 Shigellosis
    1147 (CHUK)
   05166 HTLV-I infection
    1147 (CHUK)
   05162 Measles
    1147 (CHUK)
   05161 Hepatitis B
    1147 (CHUK)
   05160 Hepatitis C
    1147 (CHUK)
   05168 Herpes simplex infection
    1147 (CHUK)
   05169 Epstein-Barr virus infection
    1147 (CHUK)
   05145 Toxoplasmosis
    1147 (CHUK)
   05142 Chagas disease (American trypanosomiasis)
    1147 (CHUK)
  Drug resistance
   01523 Antifolate resistance
    1147 (CHUK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     1147 (CHUK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  IKK family [OT]
   1147 (CHUK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O15111(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
10q24.31
AA seq 745 aa AA seqDB search
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHL
STIIHEANEEQGNSMMNLDWSWLTE
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ctgggcaccggcggcttcgggaacgtctgtctgtaccagcatcgggaacttgatctcaaa
atagcaattaagtcttgtcgcctagagctaagtaccaaaaacagagaacgatggtgccat
gaaatccagattatgaagaagttgaaccatgccaatgttgtaaaggcctgtgatgttcct
gaagaattgaatattttgattcatgatgtgcctcttctagcaatggaatactgttctgga
ggagatctccgaaagctgctcaacaaaccagaaaattgttgtggacttaaagaaagccag
atactttctttactaagtgatatagggtctgggattcgatatttgcatgaaaacaaaatt
atacatcgagatctaaaacctgaaaacatagttcttcaggatgttggtggaaagataata
cataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctgtgtacatct
tttgtgggaacactgcagtatctggccccagagctctttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtatttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgtcaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttagtagtagaacccatggaaaactggctacagttgatgttg
aattgggaccctcagcagagaggaggacctgttgaccttactttgaagcagccaagatgt
tttgtattaatggatcacattttgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttctgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactggaataaatactggttctcaagaacttctttcagagacaggaatt
tctctggatcctcggaaaccagcctctcaatgtgttctagatggagttagaggctgtgat
agctatatggtttatttgtttgataaaagtaaaactgtatatgaagggccatttgcttcc
agaagtttatctgattgtgtaaattatattgtacaggacagcaaaatacagcttccaatt
atacagctgcgtaaagtgtgggctgaagcagtgcactatgtgtctggactaaaagaagac
tatagcaggctctttcagggacaaagggcagcaatgttaagtcttcttagatataatgct
aacttaacaaaaatgaagaacactttgatctcagcatcacaacaactgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggagagatacagcgagcagatgacgtat
gggatatcttcagaaaaaatgctaaaagcatggaaagaaatggaagaaaaggccatccac
tatgctgaggttggtgtcattggatacctggaggatcagattatgtctttgcatgctgaa
atcatggagctacagaagagcccctatggaagacgtcagggagacttgatggaatctctg
gaacagcgtgccattgatctatataagcagttaaaacacagaccttcagatcactcctac
agtgacagcacagagatggtgaaaatcattgtgcacactgtgcagagtcaggaccgtgtg
ctcaaggagctgtttggtcatttgagcaagttgttgggctgtaagcagaagattattgat
ctactccctaaggtggaagtggccctcagtaatatcaaagaagctgacaatactgtcatg
ttcatgcagggaaaaaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtcccttgtaggatccagtctagaaggtgcagtaacccctcagacatca
gcatggctgcccccgacttcagcagaacatgatcattctctgtcatgtgtggtaactcct
caagatggggagacttcagcacaaatgatagaagaaaatttgaactgccttggccattta
agcactattattcatgaggcaaatgaggaacagggcaatagtatgatgaatcttgattgg
agttggttaacagaatga

KEGG   Homo sapiens (human): 3551Help
Entry
3551              CDS       T01001                                 

Gene name
IKBKB, IKK-beta, IKK2, IKKB, IMD15, NFKBIKB
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit beta
  KO
K07209  
inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
hsa  Homo sapiens (human)
Pathway
Antifolate resistance
MAPK signaling pathway
Ras signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
IL-17 signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Hepatitis C
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
MicroRNAs in cancer
Pancreatic cancer
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Fluid shear stress and atherosclerosis
Module
Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3551 (IKBKB)
   04010 MAPK signaling pathway
    3551 (IKBKB)
   04064 NF-kappa B signaling pathway
    3551 (IKBKB)
   04668 TNF signaling pathway
    3551 (IKBKB)
   04068 FoxO signaling pathway
    3551 (IKBKB)
   04151 PI3K-Akt signaling pathway
    3551 (IKBKB)
   04150 mTOR signaling pathway
    3551 (IKBKB)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    3551 (IKBKB)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3551 (IKBKB)
   04621 NOD-like receptor signaling pathway
    3551 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    3551 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    3551 (IKBKB)
   04660 T cell receptor signaling pathway
    3551 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    3551 (IKBKB)
   04659 Th17 cell differentiation
    3551 (IKBKB)
   04657 IL-17 signaling pathway
    3551 (IKBKB)
   04662 B cell receptor signaling pathway
    3551 (IKBKB)
   04062 Chemokine signaling pathway
    3551 (IKBKB)
  Endocrine system
   04910 Insulin signaling pathway
    3551 (IKBKB)
   04920 Adipocytokine signaling pathway
    3551 (IKBKB)
  Nervous system
   04722 Neurotrophin signaling pathway
    3551 (IKBKB)
  Development
   04380 Osteoclast differentiation
    3551 (IKBKB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3551 (IKBKB)
   05206 MicroRNAs in cancer
    3551 (IKBKB)
   05212 Pancreatic cancer
    3551 (IKBKB)
   05221 Acute myeloid leukemia
    3551 (IKBKB)
   05220 Chronic myeloid leukemia
    3551 (IKBKB)
   05215 Prostate cancer
    3551 (IKBKB)
   05222 Small cell lung cancer
    3551 (IKBKB)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    3551 (IKBKB)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    3551 (IKBKB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3551 (IKBKB)
   04931 Insulin resistance
    3551 (IKBKB)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3551 (IKBKB)
   05131 Shigellosis
    3551 (IKBKB)
   05166 HTLV-I infection
    3551 (IKBKB)
   05164 Influenza A
    3551 (IKBKB)
   05161 Hepatitis B
    3551 (IKBKB)
   05160 Hepatitis C
    3551 (IKBKB)
   05168 Herpes simplex infection
    3551 (IKBKB)
   05169 Epstein-Barr virus infection
    3551 (IKBKB)
   05145 Toxoplasmosis
    3551 (IKBKB)
   05142 Chagas disease (American trypanosomiasis)
    3551 (IKBKB)
  Drug resistance
   01523 Antifolate resistance
    3551 (IKBKB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     3551 (IKBKB)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  IKK family [OT]
   3551 (IKBKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O14920(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
8p11.21
AA seq 756 aa AA seqDB search
MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
VDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGCF
KALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLA
LIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN
LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQS
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPEPAKKSEELVAEAHNLCTLLE
NAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgagctggtcaccttccctgacaacgcagacatgtggggcctgggaaatgaaagagcgc
cttgggacagggggatttggaaatgtcatccgatggcacaatcaggaaacaggtgagcag
attgccatcaagcagtgccggcaggagctcagcccccggaaccgagagcggtggtgcctg
gagatccagatcatgagaaggctgacccaccccaatgtggtggctgcccgagatgtccct
gaggggatgcagaacttggcgcccaatgacctgcccctgctggccatggagtactgccaa
ggaggagatctccggaagtacctgaaccagtttgagaactgctgtggtctgcgggaaggt
gccatcctcaccttgctgagtgacattgcctctgcgcttagataccttcatgaaaacaga
atcatccatcgggatctaaagccagaaaacatcgtcctgcagcaaggagaacagaggtta
atacacaaaattattgacctaggatatgccaaggagctggatcagggcagtctttgcaca
tcattcgtggggaccctgcagtacctggccccagagctactggagcagcagaagtacaca
gtgaccgtcgactactggagcttcggcaccctggcctttgagtgcatcacgggcttccgg
cccttcctccccaactggcagcccgtgcagtggcattcaaaagtgcggcagaagagtgag
gtggacattgttgttagcgaagacttgaatggaacggtgaagttttcaagctctttaccc
taccccaataatcttaacagtgtcctggctgagcgactggagaagtggctgcaactgatg
ctgatgtggcacccccgacagaggggcacggatcccacgtatgggcccaatggctgcttc
aaggccctggatgacatcttaaacttaaagctggttcatatcttgaacatggtcacgggc
accatccacacctaccctgtgacagaggatgagagtctgcagagcttgaaggccagaatc
caacaggacacgggcatcccagaggaggaccaggagctgctgcaggaagcgggcctggcg
ttgatccccgataagcctgccactcagtgtatttcagacggcaagttaaatgagggccac
acattggacatggatcttgtttttctctttgacaacagtaaaatcacctatgagactcag
atctccccacggccccaacctgaaagtgtcagctgtatccttcaagagcccaagaggaat
ctcgccttcttccagctgaggaaggtgtggggccaggtctggcacagcatccagaccctg
aaggaagattgcaaccggctgcagcagggacagcgagccgccatgatgaatctcctccga
aacaacagctgcctctccaaaatgaagaattccatggcttccatgtctcagcagctcaag
gccaagttggatttcttcaaaaccagcatccagattgacctggagaagtacagcgagcaa
accgagtttgggatcacatcagataaactgctgctggcctggagggaaatggagcaggct
gtggagctctgtgggcgggagaacgaagtgaaactcctggtagaacggatgatggctctg
cagaccgacattgtggacttacagaggagccccatgggccggaagcaggggggaacgctg
gacgacctagaggagcaagcaagggagctgtacaggagactaagggaaaaacctcgagac
cagcgaactgagggtgacagtcaggaaatggtacggctgctgcttcaggcaattcagagc
ttcgagaagaaagtgcgagtgatctatacgcagctcagtaaaactgtggtttgcaagcag
aaggcgctggaactgttgcccaaggtggaagaggtggtgagcttaatgaatgaggatgag
aagactgttgtccggctgcaggagaagcggcagaaggagctctggaatctcctgaagatt
gcttgtagcaaggtccgtggtcctgtcagtggaagcccggatagcatgaatgcctctcga
cttagccagcctgggcagctgatgtctcagccctccacggcctccaacagcttacctgag
ccagccaagaagagtgaagaactggtggctgaagcacataacctctgcaccctgctagaa
aatgccatacaggacactgtgagggaacaagaccagagtttcacggccctagactggagc
tggttacagacggaagaagaagagcacagctgcctggagcaggcctcatga

KEGG   Homo sapiens (human): 8517Help
Entry
8517              CDS       T01001                                 

Gene name
IKBKG, AMCBX1, FIP-3, FIP3, Fip3p, IKK-gamma, IKKAP1, IKKG, IMD33, IP, IP1, IP2, IPD2, NEMO, ZC2HC9
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  
inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
Antifolate resistance
MAPK signaling pathway
Ras signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
IL-17 signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Hepatitis C
Hepatitis B
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Primary immunodeficiency
Fluid shear stress and atherosclerosis
Module
Toll-like receptor signaling
Disease
H00095  
Ectodermal dysplasia associated immunodeficiency (EDA-ID)
H00540  
Osteoporosis, lymphedema, anhydrotic ectodermal dysplasia with immunodeficiency (OLEDAID)
H00645  
Incontinentia pigmenti
H01245  
Immunodeficiency without anhidrotic ectodermal  dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    8517 (IKBKG)
   04010 MAPK signaling pathway
    8517 (IKBKG)
   04064 NF-kappa B signaling pathway
    8517 (IKBKG)
   04668 TNF signaling pathway
    8517 (IKBKG)
   04151 PI3K-Akt signaling pathway
    8517 (IKBKG)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    8517 (IKBKG)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    8517 (IKBKG)
   04621 NOD-like receptor signaling pathway
    8517 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    8517 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    8517 (IKBKG)
   04660 T cell receptor signaling pathway
    8517 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    8517 (IKBKG)
   04659 Th17 cell differentiation
    8517 (IKBKG)
   04657 IL-17 signaling pathway
    8517 (IKBKG)
   04662 B cell receptor signaling pathway
    8517 (IKBKG)
   04062 Chemokine signaling pathway
    8517 (IKBKG)
  Endocrine system
   04920 Adipocytokine signaling pathway
    8517 (IKBKG)
  Development
   04380 Osteoclast differentiation
    8517 (IKBKG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8517 (IKBKG)
   05203 Viral carcinogenesis
    8517 (IKBKG)
   05212 Pancreatic cancer
    8517 (IKBKG)
   05221 Acute myeloid leukemia
    8517 (IKBKG)
   05220 Chronic myeloid leukemia
    8517 (IKBKG)
   05215 Prostate cancer
    8517 (IKBKG)
   05222 Small cell lung cancer
    8517 (IKBKG)
  Immune diseases
   05340 Primary immunodeficiency
    8517 (IKBKG)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    8517 (IKBKG)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    8517 (IKBKG)
   05131 Shigellosis
    8517 (IKBKG)
   05166 HTLV-I infection
    8517 (IKBKG)
   05161 Hepatitis B
    8517 (IKBKG)
   05160 Hepatitis C
    8517 (IKBKG)
   05168 Herpes simplex infection
    8517 (IKBKG)
   05169 Epstein-Barr virus infection
    8517 (IKBKG)
   05145 Toxoplasmosis
    8517 (IKBKG)
   05142 Chagas disease (American trypanosomiasis)
    8517 (IKBKG)
  Drug resistance
   01523 Antifolate resistance
    8517 (IKBKG)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  IKK family [OT]
   8517 (IKBKG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y6K9(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
Xq28
AA seq 419 aa AA seqDB search
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ
ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH
VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaataggcacctctggaagagccaactgtgtgagatggtgcagcccagtggtggcccg
gcagcagatcaggacgtactgggcgaagagtctcctctggggaagccagccatgctgcac
ctgccttcagaacagggcgctcctgagaccctccagcgctgcctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagattctgcgggagcgctgcgaggagcttctg
catttccaagccagccagagggaggagaaggagttcctcatgtgcaagttccaggaggcc
aggaaactggtggagagactcggcctggagaagctcgatctgaagaggcagaaggagcag
gctctgcgggaggtggagcacctgaagagatgccagcagcagatggctgaggacaaggcc
tctgtgaaagcccaggtgacgtccttgctcggggagctgcaggagagccagagtcgcttg
gaggctgccactaaggaatgccaggctctggagggtcgggcccgggcggccagcgagcag
gcgcggcagctggagagtgagcgcgaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagggccagagcgtggaggccgcgctccgcatggagcgccaggccgcc
tcggaggagaagaggaagctggcccagttgcaggtggcctatcaccagctcttccaagaa
tacgacaaccacatcaagagcagcgtggtgggcagtgagcggaagcgaggaatgcagctg
gaagatctcaaacagcagctccagcaggccgaggaggccctggtggccaaacaggaggtg
atcgataagctgaaggaggaggccgagcagcacaagattgtgatggagaccgttccggtg
ctgaaggcccaggcggatatctacaaggcggacttccaggctgagaggcaggcccgggag
aagctggccgagaagaaggagctcctgcaggagcagctggagcagctgcagagggagtac
agcaaactgaaggccagctgtcaggagtcggccaggatcgaggacatgaggaagcggcat
gtcgaggtctcccaggcccccttgccccccgcccctgcctacctctcctctcccctggcc
ctgcccagccagaggaggagcccccccgaggagccacctgacttctgctgtcccaagtgc
cagtatcaggcccctgatatggacaccctgcagatacatgtcatggagtgcattgagtag

DBGET integrated database retrieval system