KEGG   Homo sapiens (human): 114815Help
Entry
114815            CDS       T01001                                 

Gene name
SORCS1, hSorCS
Definition
(RefSeq) sortilin related VPS10 domain containing receptor 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q23-q25
AA seq 1168 aa AA seqDB search
MGKVGAGGGSQARLSALLAGAGLLILCAPGVCGGGSCCPSPHPSSAPRSASTPRGFSHQG
RPGRAPATPLPLVVRPLFSVAPGDRALSLERARGTGASMAVAARSGRRRRSGADQEKAER
GEGASRSPRGVLRDGGQQEPGTRERDPDKATRFRMEELRLTSTTFALTGDSAHNQAMVHW
SGHNSSVILILTKLYDYNLGSITESSLWRSTDYGTTYEKLNDKVGLKTILSYLYVCPTNK
RKIMLLTDPEIESSLLISSDEGATYQKYRLNFYIQSLLFHPKQEDWILAYSQDQKLYSSA
EFGRRWQLIQEGVVPNRFYWSVMGSNKEPDLVHLEARTVDGHSHYLTCRMQNCTEANRNQ
PFPGYIDPDSLIVQDHYVFVQLTSGGRPHYYVSYRRNAFAQMKLPKYALPKDMHVISTDE
NQVFAAVQEWNQNDTYNLYISDTRGVYFTLALENVQSSRGPEGNIMIDLYEVAGIKGMFL
ANKKIDNQVKTFITYNKGRDWRLLQAPDTDLRGDPVHCLLPYCSLHLHLKVSENPYTSGI
IASKDTAPSIIVASGNIGSELSDTDISMFVSSDAGNTWRQIFEEEHSVLYLDQGGVLVAM
KHTSLPIRHLWLSFDEGRSWSKYSFTSIPLFVDGVLGEPGEETLIMTVFGHFSHRSEWQL
VKVDYKSIFDRRCAEEDYRPWQLHSQGEACIMGAKRIYKKRKSERKCMQGKYAGAMESEP
CVCTEADFDCDYGYERHSNGQCLPAFWFNPSSLSKDCSLGQSYLNSTGYRKVVSNNCTDG
VREQYTAKPQKCPGKAPRGLRIVTADGKLTAEQGHNVTLMVQLEEGDVQRTLIQVDFGDG
IAVSYVNLSSMEDGIKHVYQNVGIFRVTVQVDNSLGSDSAVLYLHVTCPLEHVHLSLPFV
TTKNKEVNATAVLWPSQVGTLTYVWWYGNNTEPLITLEGSISFRFTSEGMNTITVQVSAG
NAILQDTKTIAVYEEFRSLRLSFSPNLDDYNPDIPEWRRDIGRVIKKSLVEATGVPGQHI
LVAVLPGLPTTAELFVLPYQDPAGENKRSTDDLEQISELLIHTLNQNSVHFELKPGVRVL
VHAAHLTAAPLVDLTPTHSGSAMLMLLSVVFVGLAVFVIYKFKRRVALPSPPSPSTQPGD
SSLRLQRARHATPPSTPKRGSAGAQYAI
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagttggcgccggcggcggctcccaagcccggctgagcgcgctcctcgccggc
gcggggctcttgatcctctgcgccccgggcgtctgcggcggcggctcctgctgcccctcg
ccgcaccccagctccgctccacgctcggcctcgacccctaggggcttttcccaccagggg
cggccaggcagggctcctgccacgcccctgcccctcgtagtgcgtcccctgttctcagtg
gcccccggggaccgagcgctatccctggagcgggctcggggcactggggcatccatggcg
gttgctgcacgctccggccggaggagacggagcggagcggatcaggagaaggcagaacgg
ggagagggcgcgagtcggagcccccggggagtgctaagagatggagggcagcaggagcct
gggactcgggagcgggacccggacaaagccacccgcttccggatggaggagctgagactg
accagcaccacgtttgcgctgacgggagactcagcacacaaccaagccatggtccactgg
tctggccacaacagcagcgtgattctcattttgacaaagctctatgactataacctgggg
agcatcacagagagctcgctttggaggtcaaccgattatggaacaacctatgagaagctg
aatgataaagttggtttgaaaaccattttgagctatctctatgtgtgtcctaccaacaag
cgtaagataatgttactcacagacccggagattgagagcagtttattgatcagctcagat
gaaggggcaacttatcaaaagtaccggctgaacttctacattcaaagcttgctttttcac
cccaaacaagaagactggattctggcatacagtcaagaccaaaagttatacagctctgct
gaatttgggagaagatggcagcttatccaagaaggggttgtaccaaacaggttctactgg
tctgtgatggggtcaaataaagaaccagaccttgtgcatcttgaggccagaactgtggat
ggtcattcacattatctaacttgccgaatgcagaactgtacagaggccaacaggaatcag
ccttttccaggctacattgacccagactctttgattgttcaggatcattatgtgtttgtt
cagctgacatcaggagggcggccacattactacgtgtcctaccgaaggaatgcatttgcc
caaatgaagcttccgaaatatgctttgcccaaggacatgcatgttatcagcaccgatgag
aatcaggtgttcgcagcggtccaagaatggaaccagaatgacacgtacaacctctacatc
tcagacacacgtggtgtctacttcaccctggccttggagaatgtccagagcagcagaggc
cctgagggcaacatcatgatcgacctctatgaggtagcagggataaagggaatgttcttg
gctaacaagaagattgacaaccaagtgaagactttcatcacatataacaaaggcagagac
tggcgtttgctgcaggcgccggacacggatctaaggggggaccccgtgcactgcttgctg
ccctattgctcactacaccttcacctgaaggtctctgagaatccctacacatcagggatc
attgccagcaaagacacagctccaagcatcatagtggcatcaggtaatataggttctgaa
ttgtcagacactgacatcagcatgtttgtctcttcagatgcagggaacacctggagacag
atctttgaagaagagcacagtgttttgtacctggatcaaggtggagtcctggttgctatg
aaacacacatctctcccaattcgacatctttggttgagttttgatgaagggagatcttgg
agcaaatacagtttcacatctattccactttttgtggatggggttctgggtgagcctgga
gaagagactctcatcatgacagtgtttggacacttcagccaccgctctgaatggcagctg
gtcaaagtagattacaagtccatttttgatagacggtgtgccgaagaggactacagacct
tggcagctgcacagccagggggaagcatgtatcatgggagcaaaaaggatatataagaag
cgaaaatcagagcggaagtgtatgcaaggaaaatatgcaggagctatggaatctgaaccc
tgtgtctgcactgaggctgattttgattgcgactatggttatgagcgacacagcaatggc
cagtgcctgccggcattttggttcaatccatcctctctgtcaaaggattgcagcttggga
cagagttacctcaatagtactgggtacaggaaggtggtttccaataattgcactgatggc
gtaagggaacagtacactgccaaaccgcagaagtgcccagggaaagccccgcgggggctg
cggatagtcacggctgatggaaagctgacagcggaacaaggacacaacgtcactctcatg
gtgcaattagaagagggtgatgttcagcggacactcatccaagtggactttggcgatggt
atcgcggtgtcttacgtcaatctcagctccatggaagatgggatcaaacacgtctatcag
aacgtgggcattttccgtgtgaccgtgcaggtggacaacagtctgggttctgacagcgcc
gtcctgtacttacatgtaacttgtcccttggagcacgtgcacctgtctcttccctttgtc
accacaaagaacaaagaggtcaatgcgacggcagtgctgtggcccagccaagtgggcacc
ctcacttacgtgtggtggtacggaaacaacacggagcctttgatcaccttggagggaagc
atatccttcagatttacttcagaaggaatgaataccatcacagtgcaggtctcagctggg
aatgccatcctacaagacacaaagaccatcgcagtatatgaggaattccggtctcttcgc
ttgtccttttctccaaacctggatgactacaacccggacatccctgagtggaggagggac
atcggtcgagtcatcaaaaaatccctggtggaagccacaggggttccaggccagcacatc
ctggtggcggtgctccctggcttacccaccactgctgaactctttgtcctaccctatcag
gatccagctggagaaaacaaaaggtcaactgatgacctggagcagatatcagaattgctg
atccacacgctcaaccaaaactcagtacacttcgagctgaagccaggagtccgagtcctt
gtccatgctgctcacttaacagcggcccccctggtggacctcactccaacccacagtgga
tctgccatgctgatgctgctctcagtggtgtttgtggggctggcagtgttcgtcatctac
aagtttaaaaggagagtagctttaccctcccctccctccccttctactcaacctggtgac
tcatctctccgattgcaaagagcaagacacgccactccgccttcaacgccaaagcgggga
tctgctggggcacagtatgcaatttaa

DBGET integrated database retrieval system