KEGG   Homo sapiens (human): 115111Help
Entry
115111            CDS       T01001                                 

Gene name
SLC26A7, SUT2
Definition
(RefSeq) solute carrier family 26 member 7
  KO
K13962  
solute carrier family 26 (anion exchange transporter), member 7
Organism
hsa  Homo sapiens (human)
Pathway
Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    115111 (SLC26A7)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC26: Multifunctional anion exchanger
   115111 (SLC26A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q23
AA seq 656 aa AA seqDB search
MTGAKRKKKSMLWSKMHTPQCEDIIQWCRRRLPILDWAPHYNLKENLLPDTVSGIMLAVQ
QVTQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGHHVATGTFALTSLISANAVERIVP
QNMQNLTTQSNTSVLGLSDFEMQRIHVAAAVSFLGGVIQVAMFVLQLGSATFVVTEPVIS
AMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPQGIPSPRAP
PMNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLSNIVSSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAMTVSI
KNMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNMIQKENACNQPLDDI
SKCEQNTLLNSLSNGNCNEEASQSCPNEKCYLILDCSGFTFFDYSGVSMLVEVYMDCKGR
SVDVLLAHCTASLIKAMTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHSEV
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgacaggagcaaagaggaaaaagaaaagcatgctttggagcaagatgcataccccccag
tgtgaagacattatacagtggtgtagaaggcgactgcccattttggattgggcaccacat
tacaatctgaaagaaaacttgcttccagacactgtgtctgggataatgttggcagttcaa
caggtgacccaaggattggcctttgctgttctctcatctgtgcacccagtgtttggttta
tatgggtctctgtttcctgccataatttatgccatatttggaatgggacatcatgttgcc
acaggcacctttgccttgacatccttaatatcagccaacgccgtggaacggattgtccct
cagaacatgcagaatctcaccacacagagtaacacaagcgtgctgggcttatccgacttt
gaaatgcaaaggatccacgttgctgcagcagtttccttcttgggaggtgtgattcaggtg
gccatgtttgtgctgcaactgggcagtgccacatttgtggtcacagagcctgtgatcagc
gcaatgacaactggggctgccacccatgtggtgacttcacaagtcaaatatctcttggga
atgaaaatgccatatatatccggaccacttggattcttttatatttatgcatatgttttt
gaaaacatcaagtctgtgcgactggaagcattgcttttatccttgctgagcattgtggtc
cttgttcttgttaaagagctgaatgaacagtttaaaaggaaaattaaagttgttcttcct
gtagatttagttttgattattgctgcatcatttgcttgttattgcaccaatatggaaaac
acatatggattagaagtagttggtcatattccacaaggaattccctcacctagagctccc
ccgatgaacatcctctctgcggtgatcactgaagctttcggagtggcacttgtaggctat
gtggcctcactggctcttgctcaaggatctgccaaaaaattcaaatattcaattgatgac
aaccaggaatttttggcccatggcctcagcaatatagtttcttcatttttcttctgcata
ccaagtgctgctgccatgggaaggacggctggcctgtacagcacaggagcgaagacacag
gtggcttgtctaatatcttgcattttcgtccttatagtcatctatgcaataggacctttg
ctttactggctgcccatgtgtgtccttgcaagcattattgttgtgggactgaagggaatg
ctaatacagttccgagatttaaaaaaatattggaatgtggataaaatcgattggggaata
tgggtcagtacatatgtatttacaatatgctttgctgccaatgtgggactgctgtttggt
gttgtttgtaccatagctatagtgataggacgcttcccaagagcaatgactgtaagtata
aaaaatatgaaagaaatggaatttaaagtgaagacagaaatggacagtgaaaccctgcag
caggtgaaaattatctcaataaacaacccgcttgttttcctgaatgcaaaaaaattttat
actgatttaatgaacatgatccaaaaggaaaatgcctgtaatcagccacttgatgatatc
agcaagtgtgaacaaaacacattgcttaattccctatccaatggcaactgcaatgaagaa
gcttcacagtcctgccctaatgagaagtgttatttaatcctggattgcagtggatttacc
ttttttgactattctggagtctccatgcttgttgaggtttacatggactgtaaaggcagg
agtgtggatgtattgttagcccattgtacagcttccttgataaaagcaatgacgtattat
ggaaacctagactcagagaaaccaattttttttgaatcggtatctgctgcaataagtcat
atccattcaaataagaatttgagcaaactcagtgaccacagtgaagtctga

DBGET integrated database retrieval system