KEGG   Homo sapiens (human): 115201Help
Entry
115201            CDS       T01001                                 

Gene name
ATG4A, APG4A, AUTL2
Definition
autophagy related 4A, cysteine peptidase
Orthology
K08342  
cysteine protease ATG4 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:hsa04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq22.1-q22.3
AA seq 398 aa AA seqDB search
MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRK
FSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLD
RKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIE
DIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVY
VDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTF
HCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWP
PFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggagtcagttttatccaagtatgaagatcagattactattttcactgactacctagaa
gaatatccagatacagatgagctggtatggatcttagggaagcagcatctccttaaaaca
gaaaaatctaagctgttgtctgatataagtgctcgtctatggtttacatacagaaggaaa
ttttcaccaattggtggaacgggcccttcatcagatgctggttggggatgtatgctacgc
tgtggacagatgatgctggctcaagcccttatctgtagacacttgggaagggactggagc
tgggagaaacaaaaagaacaacccaaagaataccaacgcatcctacagtgcttcttagat
agaaaagattgttgctactctatccatcaaatggcacaaatgggtgtaggagaagggaaa
tcaattggagaatggtttggaccaaatacagttgcacaggtgttaaaaaaacttgcttta
tttgacgaatggaattccttggctgtttatgtttcaatggataacacagtggtcattgaa
gatatcaaaaaaatgtgccgtgtccttcccttgagtgctgacacagctggtgacaggcct
cccgattctttaactgcttcaaaccagagtaagggcacctctgcctactgctcagcctgg
aaacccctgctgctcattgtgccccttcgcctgggcataaaccaaatcaatcctgtctat
gttgatgcattcaaagagtgttttaagatgccacagtctttaggggcattaggaggaaaa
ccaaataacgcgtattatttcataggattcttaggtgacgagctcatcttcttggaccct
catacaacccagacctttgttgacactgaagagaatggaacggttaatgaccagactttc
cattgcctgcagtccccacagcgaatgaacatcctaaacctggatccttcagttgcattg
ggatttttctgcaaagaagaaaaagactttgataactggtgtagccttgttcagaaggaa
attctaaaggagaatttaaggatgtttgaattagttcagaaacatccatcacactggcct
ccctttgtacctccagccaagccagaagtgacaaccactggggcagaattcattgactct
actgagcaactggaggagtttgatctggaggaagattttgagattctgagtgtgtag

DBGET integrated database retrieval system