KEGG   Homo sapiens (human): 115201Help
Entry
115201            CDS       T01001                                 

Gene name
ATG4A, APG4A, AUTL2
Definition
(RefSeq) autophagy related 4A cysteine peptidase
  KO
K08342  cysteine protease ATG4 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    115201 (ATG4A)
   04136 Autophagy - other eukaryotes
    115201 (ATG4A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     115201 (ATG4A)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C54: Aut2 peptidase family
   115201 (ATG4A)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    115201 (ATG4A)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    115201 (ATG4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C54
Motif
Other DBs
NCBI-GeneID: 115201
NCBI-ProteinID: NP_443168
OMIM: 300663
HGNC: 16489
Ensembl: ENSG00000101844
Vega: OTTHUMG00000022176
Pharos: Q8WYN0(Tbio)
UniProt: Q8WYN0
Structure
PDB: 

Jmol
Position
Xq22.3
AA seq 398 aa AA seqDB search
MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRK
FSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLD
RKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIE
DIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVY
VDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTF
HCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWP
PFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggagtcagttttatccaagtatgaagatcagattactattttcactgactacctagaa
gaatatccagatacagatgagctggtatggatcttagggaagcagcatctccttaaaaca
gaaaaatctaagctgttgtctgatataagtgctcgtctatggtttacatacagaaggaaa
ttttcaccaattggtggaacgggcccttcatcagatgctggttggggatgtatgctacgc
tgtggacagatgatgctggctcaagcccttatctgtagacacttgggaagggactggagc
tgggagaaacaaaaagaacaacccaaagaataccaacgcatcctacagtgcttcttagat
agaaaagattgttgctactctatccatcaaatggcacaaatgggtgtaggagaagggaaa
tcaattggagaatggtttggaccaaatacagttgcacaggtgttaaaaaaacttgcttta
tttgacgaatggaattccttggctgtttatgtttcaatggataacacagtggtcattgaa
gatatcaaaaaaatgtgccgtgtccttcccttgagtgctgacacagctggtgacaggcct
cccgattctttaactgcttcaaaccagagtaagggcacctctgcctactgctcagcctgg
aaacccctgctgctcattgtgccccttcgcctgggcataaaccaaatcaatcctgtctat
gttgatgcattcaaagagtgttttaagatgccacagtctttaggggcattaggaggaaaa
ccaaataacgcgtattatttcataggattcttaggtgacgagctcatcttcttggaccct
catacaacccagacctttgttgacactgaagagaatggaacggttaatgaccagactttc
cattgcctgcagtccccacagcgaatgaacatcctaaacctggatccttcagttgcattg
ggatttttctgcaaagaagaaaaagactttgataactggtgtagccttgttcagaaggaa
attctaaaggagaatttaaggatgtttgaattagttcagaaacatccatcacactggcct
ccctttgtacctccagccaagccagaagtgacaaccactggggcagaattcattgactct
actgagcaactggaggagtttgatctggaggaagattttgagattctgagtgtgtag

DBGET integrated database retrieval system