KEGG   Homo sapiens (human): 1154Help
Entry
1154              CDS       T01001                                 

Gene name
CISH, BACTS2, CIS, CIS-1, G18, SOCS
Definition
(RefSeq) cytokine inducible SH2 containing protein
  KO
K04701  
cytokine inducible SH2-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Module
ECS complex
JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    1154 (CISH)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    1154 (CISH)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     1154 (CISH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 258 aa AA seqDB search
MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAP
TPALPMPKEDAPSDPALPAPPPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDC
LPLPRRMADYLRQYPFQL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggtcctctgcgttcagggacctcgtcctttgctggctgtggagcggactgggcagcgg
cccctgtgggccccgtccctggaactgcccaagccagtcatgcagcccttgcctgctggg
gccttcctcgaggaggtggcagagggtaccccagcccagacagagagtgagccaaaggtg
ctggacccagaggaggatctgctgtgcatagccaagaccttctcctaccttcgggaatct
ggctggtattggggttccattacggccagcgaggcccgacaacacctgcagaagatgcca
gaaggcacgttcttagtacgtgacagcacgcaccccagctacctgttcacgctgtcagtg
aaaaccactcgtggccccaccaatgtacgcattgagtatgccgactccagcttccgtctg
gactccaactgcttgtccaggccacgcatcctggcctttccggatgtggtcagccttgtg
cagcactatgtggcctcctgcactgctgatacccgaagcgacagccccgatcctgctccc
accccggccctgcctatgcctaaggaggatgcgcctagtgacccagcactgcctgctcct
ccaccagccactgctgtacacctaaaactggtgcagccctttgtacgcagaagcagtgcc
cgcagcctgcaacacctgtgccgccttgtcatcaaccgtctggtggccgacgtggactgc
ctgccactgccccggcgcatggccgactacctccgacagtaccccttccagctctga

DBGET integrated database retrieval system