KEGG   Homo sapiens (human): 115650Help
Entry
115650            CDS       T01001                                 

Gene name
TNFRSF13C, BAFF-R, BAFFR, BROMIX, CD268, CVID4, prolixin
Definition
tumor necrosis factor receptor superfamily, member 13C
Orthology
K05151  
tumor necrosis factor receptor superfamily member 13C
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Intestinal immune network for IgA production
HTLV-I infection
Primary immunodeficiency
Disease
H00088  
Common variable immunodeficiency (CVID)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    115650 (TNFRSF13C)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    115650 (TNFRSF13C)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    115650 (TNFRSF13C)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    115650 (TNFRSF13C)
  Infectious diseases
   05166 HTLV-I infection
    115650 (TNFRSF13C)
Cellular antigens [BR:hsa04090]
 Proteins
  115650 (TNFRSF13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1-q13.31
AA seq 184 aa AA seqDB search
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQ
ESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGD
KDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAG
PEQQ
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgagggccccggagcctgcggggcagggacgcgccagcccccacgccctgcgtc
ccggccgagtgcttcgacctgctggtccgccactgcgtggcctgcgggctcctgcgcacg
ccgcggccgaaaccggccggggccagcagccctgcgcccaggacggcgctgcagccgcag
gagtcggtgggcgcgggggccggcgaggcggcgctgcccctgcccgggctgctctttggc
gcccccgcgctgctgggcctggcactggtcctggcgctggtcctggtgggtctggtgagc
tggaggcggcgacagcggcggcttcgcggcgcgtcctccgcagaggcccccgacggagac
aaggacgccccagagcccctggacaaggtcatcattctgtctccgggaatctctgatgcc
acagctcctgcctggcctcctcctggggaagacccaggaaccaccccacctggccacagt
gtccctgtgccagccacagagctgggctccactgaactggtgaccaccaagacggccggc
cctgagcaacaatag

DBGET integrated database retrieval system