KEGG   Homo sapiens (human): 115650Help
Entry
115650            CDS       T01001                                 

Gene name
TNFRSF13C, BAFF-R, BAFFR, BROMIX, CD268, CVID4, prolixin
Definition
tumor necrosis factor receptor superfamily, member 13C
Orthology
K05151  
tumor necrosis factor receptor superfamily member 13C
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Intestinal immune network for IgA production
HTLV-I infection
Primary immunodeficiency
Disease
H00088  
Common variable immunodeficiency (CVID)
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:hsa04672]
Human Diseases; Immune diseases; Primary immunodeficiency [PATH:hsa05340]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1-q13.31
AA seq 184 aa AA seqDB search
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQ
ESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGD
KDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAG
PEQQ
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgagggccccggagcctgcggggcagggacgcgccagcccccacgccctgcgtc
ccggccgagtgcttcgacctgctggtccgccactgcgtggcctgcgggctcctgcgcacg
ccgcggccgaaaccggccggggccagcagccctgcgcccaggacggcgctgcagccgcag
gagtcggtgggcgcgggggccggcgaggcggcgctgcccctgcccgggctgctctttggc
gcccccgcgctgctgggcctggcactggtcctggcgctggtcctggtgggtctggtgagc
tggaggcggcgacagcggcggcttcgcggcgcgtcctccgcagaggcccccgacggagac
aaggacgccccagagcccctggacaaggtcatcattctgtctccgggaatctctgatgcc
acagctcctgcctggcctcctcctggggaagacccaggaaccaccccacctggccacagt
gtccctgtgccagccacagagctgggctccactgaactggtgaccaccaagacggccggc
cctgagcaacaatag

DBGET integrated database retrieval system