KEGG   Homo sapiens (human): 115727Help
Entry
115727            CDS       T01001                                 

Gene name
RASGRP4
Definition
RAS guanyl releasing protein 4
Orthology
K12363  
RAS guanyl-releasing protein 4
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    115727 (RASGRP4)
   04010 MAPK signaling pathway
    115727 (RASGRP4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    115727 (RASGRP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.1
AA seq 659 aa AA seqDB search
MNRKDSKRKSHQECTGKIGGRGRPRQVRRHKTCPSPREISKVMASMNLGLLSEGGCSEDE
LLEKCIQSFDSAGSLCHEDHMLNMVLAMHSWVLPSADLAARLLTSYQKATGDTQELRRLQ
ICHLVRYWLMRHPEVMHQDPQLEEVIGRFWATVAREGNSAQRRLGDSSDLPGLGKKRKVS
LLFDHLETGELAQHLTYLEFRSFQAITPQDLRSYVLQGSVRGCPALEGSVGLSNSVSRWV
QVMVLSRPGPLQRAQVLDKFIHVAQRLHQLQNFNTLMAVTGGLCHSAISRLKDSHAHLSP
DSTKALLELTELLASHNNYARYRRTWAGCAGFRLPVLGVHLKDLVSLHEAQPDRLPDGRL
HLPKLNNLYLRLQELVALQGQHPPCSANEDLLHLLTLSLDLFYTEDEIYELSYAREPRCP
KSLPPSPFNAPLVVEWAPGVTPKPDRVTLGRHVEQLVESVFKNYDPEGRGTISQEDFERL
SGNFPFACHGLHPPPRQGRGSFSREELTGYLLRASAICSKLGLAFLHTFHEVTFRKPTFC
DSCSGFLWGVTKQGYRCRECGLCCHKHCRDQVKVECKKRPGAKGDAGPPGAPVPSTPAPH
ASCGSEENHSYTLSLEPETGCQLRHAWTQTESPHPSWETDTVPCPVMDPPSTASSKLDS
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaaagacagtaagaggaagtcccaccaggaatgcaccggaaaaataggaggg
cgaggccggccccgccaagtgcgccgccacaagacatgccccagccctcgggaaatcagc
aaggtcatggcttccatgaacctgggcctgctgagtgagggcggctgcagcgaagatgag
ctgctggagaaatgcatccagtccttcgattcagctggcagcctgtgccacgaggaccac
atgctcaacatggtgctggccatgcacagctgggtgctgccgtccgccgacctggctgcc
cgcctgctgacctcataccagaaggccacaggggacacccaggagctgagacggctgcag
atctgtcacctggtcaggtactggctgatgcgacaccctgaggtgatgcaccaggatccc
cagctagaagaagtcataggtcgtttctgggccaccgtggcccgggagggcaactcagcc
cagagaagactgggagactcttctgacctcccaggcctgggcaaaaagcgcaaagtgtcc
ttgcttttcgaccacttggagacgggggagctggctcagcacctcacctacctggagttc
cggtccttccaggctatcacgccccaggacctgcggagctacgttttgcagggctcagta
cgaggctgcccggccctggagggctccgtaggtctcagcaacagcgtgtcccgctgggtg
caggtgatggtgctgagccgtcccgggcccctacagcgtgcacaggtgctggacaagttc
attcacgtggcacagaggctccaccagctgcagaatttcaacacgctgatggcagtcaca
gggggcctgtgtcacagtgccatctccagactcaaggactcccatgcccacctgagccct
gacagcaccaaggccctcctggagctcactgagctccttgcctcccacaacaactacgcc
cgctaccgccgcacctgggctggctgcgcgggtttccggctgcctgtactgggcgtgcac
ctcaaggacctggtgtccctgcatgaggcacagcccgacaggttgcctgacggccgcctg
cacctacccaagctgaacaacctctacctgcggctgcaggagctggtggccctccaaggg
cagcatccaccctgcagcgccaatgaggatctgctgcacctgctcacgctctccctggac
ctcttctacacggaagacgagatctatgagctttcttatgcccgggagccgcgttgtccc
aagagcctgccaccctcccccttcaatgcacctctggtggtggagtgggcccctggtgtg
acacccaagccggacagggtcacactgggtcggcatgtggagcagctggtggagtctgtg
ttcaagaattatgaccctgaaggccgaggaacaatctctcaggaggactttgagcgactc
tcgggcaattttcccttcgcctgccatgggcttcacccacccccacgccaggggagagga
tccttcagcagagaggagctgacagggtacctgctccgggccagcgccatctgctccaag
ttgggcctggccttcctgcacaccttccatgaggtcaccttccgaaagcctaccttctgc
gacagctgcagtggcttcctctggggtgtcaccaagcaaggctaccgctgtcgggagtgc
gggctgtgttgccacaaacactgcagagaccaggtgaaggtagaatgtaagaagaggcca
ggggccaagggcgatgcaggaccccccggagctcctgtcccatccacaccagctccccat
gccagctgtggctccgaggaaaatcactcctacacgctatccctggagcctgagactggg
tgccagcttcgccatgcctggacccagactgaatccccacacccttcctgggaaacagat
acggtcccctgcccggtgatggacccaccatcaactgcatcctccaagctggattcctag

DBGET integrated database retrieval system