KEGG   Homo sapiens (human): 115727Help
Entry
115727            CDS       T01001                                 

Gene name
RASGRP4
Definition
RAS guanyl releasing protein 4
Orthology
K12363  
RAS guanyl-releasing protein 4
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    115727 (RASGRP4)
   04010 MAPK signaling pathway
    115727 (RASGRP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.1
AA seq 659 aa AA seqDB search
MNRKDSKRKSHQECTGKIGGRGRPRQVRRHKTCPSPREISKVMASMNLGLLSEGGCSEDE
LLEKCIQSFDSAGSLCHEDHMLNMVLAMHSWVLPSADLAARLLTSYQKATGDTQELRRLQ
ICHLVRYWLMRHPEVMHQDPQLEEVIGRFWATVAREGNSAQRRLGDSSDLPGLGKKRKVS
LLFDHLETGELAQHLTYLEFRSFQAITPQDLRSYVLQGSVRGCPALEGSVGLSNSVSRWV
QVMVLSRPGPLQRAQVLDKFIHVAQRLHQLQNFNTLMAVTGGLCHSAISRLKDSHAHLSP
DSTKALLELTELLASHNNYARYRRTWAGCAGFRLPVLGVHLKDLVSLHEAQPDRLPDGRL
HLPKLNNLYLRLQELVALQGQHPPCSANEDLLHLLTLSLDLFYTEDEIYELSYAREPRCP
KSLPPSPFNAPLVVEWAPGVTPKPDRVTLGRHVEQLVESVFKNYDPEGRGTISQEDFERL
SGNFPFACHGLHPPPRQGRGSFSREELTGYLLRASAICSKLGLAFLHTFHEVTFRKPTFC
DSCSGFLWGVTKQGYRCRECGLCCHKHCRDQVKVECKKRPGAKGDAGPPGAPVPSTPAPH
ASCGSEENHSYTLSLEPETGCQLRHAWTQTESPHPSWETDTVPCPVMDPPSTASSKLDS
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaaagacagtaagaggaagtcccaccaggaatgcaccggaaaaataggaggg
cgaggccggccccgccaagtgcgccgccacaagacatgccccagccctcgggaaatcagc
aaggtcatggcttccatgaacctgggcctgctgagtgagggcggctgcagcgaagatgag
ctgctggagaaatgcatccagtccttcgattcagctggcagcctgtgccacgaggaccac
atgctcaacatggtgctggccatgcacagctgggtgctgccgtccgccgacctggctgcc
cgcctgctgacctcataccagaaggccacaggggacacccaggagctgagacggctgcag
atctgtcacctggtcaggtactggctgatgcgacaccctgaggtgatgcaccaggatccc
cagctagaagaagtcataggtcgtttctgggccaccgtggcccgggagggcaactcagcc
cagagaagactgggagactcttctgacctcccaggcctgggcaaaaagcgcaaagtgtcc
ttgcttttcgaccacttggagacgggggagctggctcagcacctcacctacctggagttc
cggtccttccaggctatcacgccccaggacctgcggagctacgttttgcagggctcagta
cgaggctgcccggccctggagggctccgtaggtctcagcaacagcgtgtcccgctgggtg
caggtgatggtgctgagccgtcccgggcccctacagcgtgcacaggtgctggacaagttc
attcacgtggcacagaggctccaccagctgcagaatttcaacacgctgatggcagtcaca
gggggcctgtgtcacagtgccatctccagactcaaggactcccatgcccacctgagccct
gacagcaccaaggccctcctggagctcactgagctccttgcctcccacaacaactacgcc
cgctaccgccgcacctgggctggctgcgcgggtttccggctgcctgtactgggcgtgcac
ctcaaggacctggtgtccctgcatgaggcacagcccgacaggttgcctgacggccgcctg
cacctacccaagctgaacaacctctacctgcggctgcaggagctggtggccctccaaggg
cagcatccaccctgcagcgccaatgaggatctgctgcacctgctcacgctctccctggac
ctcttctacacggaagacgagatctatgagctttcttatgcccgggagccgcgttgtccc
aagagcctgccaccctcccccttcaatgcacctctggtggtggagtgggcccctggtgtg
acacccaagccggacagggtcacactgggtcggcatgtggagcagctggtggagtctgtg
ttcaagaattatgaccctgaaggccgaggaacaatctctcaggaggactttgagcgactc
tcgggcaattttcccttcgcctgccatgggcttcacccacccccacgccaggggagagga
tccttcagcagagaggagctgacagggtacctgctccgggccagcgccatctgctccaag
ttgggcctggccttcctgcacaccttccatgaggtcaccttccgaaagcctaccttctgc
gacagctgcagtggcttcctctggggtgtcaccaagcaaggctaccgctgtcgggagtgc
gggctgtgttgccacaaacactgcagagaccaggtgaaggtagaatgtaagaagaggcca
ggggccaagggcgatgcaggaccccccggagctcctgtcccatccacaccagctccccat
gccagctgtggctccgaggaaaatcactcctacacgctatccctggagcctgagactggg
tgccagcttcgccatgcctggacccagactgaatccccacacccttcctgggaaacagat
acggtcccctgcccggtgatggacccaccatcaactgcatcctccaagctggattcctag

DBGET integrated database retrieval system