KEGG   Homo sapiens (human): 115727Help
Entry
115727            CDS       T01001                                 

Gene name
RASGRP4
Definition
(RefSeq) RAS guanyl releasing protein 4
  KO
K12363  
RAS guanyl-releasing protein 4
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    115727 (RASGRP4)
   04010 MAPK signaling pathway
    115727 (RASGRP4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    115727 (RASGRP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.1
AA seq 673 aa AA seqDB search
MNRKDSKRKSHQECTGKIGGRGRPRQVRRHKTCPSPREISKVMASMNLGLLSEGGCSEDE
LLEKCIQSFDSAGSLCHEDHMLNMVLAMHSWVLPSADLAARLLTSYQKATGDTQELRRLQ
ICHLVRYWLMRHPEVMHQDPQLEEVIGRFWATVAREGNSAQRRLGDSSDLLSPGGPGPPL
PMSSPGLGKKRKVSLLFDHLETGELAQHLTYLEFRSFQAITPQDLRSYVLQGSVRGCPAL
EGSVGLSNSVSRWVQVMVLSRPGPLQRAQVLDKFIHVAQRLHQLQNFNTLMAVTGGLCHS
AISRLKDSHAHLSPDSTKALLELTELLASHNNYARYRRTWAGCAGFRLPVLGVHLKDLVS
LHEAQPDRLPDGRLHLPKLNNLYLRLQELVALQGQHPPCSANEDLLHLLTLSLDLFYTED
EIYELSYAREPRCPKSLPPSPFNAPLVVEWAPGVTPKPDRVTLGRHVEQLVESVFKNYDP
EGRGTISQEDFERLSGNFPFACHGLHPPPRQGRGSFSREELTGYLLRASAICSKLGLAFL
HTFHEVTFRKPTFCDSCSGFLWGVTKQGYRCRECGLCCHKHCRDQVKVECKKRPGAKGDA
GPPGAPVPSTPAPHASCGSEENHSYTLSLEPETGCQLRHAWTQTESPHPSWETDTVPCPV
MDPPSTASSKLDS
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaaagacagtaagaggaagtcccaccaggaatgcaccggaaaaataggaggg
cgaggccggccccgccaagtgcgccgccacaagacatgccccagccctcgggaaatcagc
aaggtcatggcttccatgaacctgggcctgctgagtgagggcggctgcagcgaagatgag
ctgctggagaaatgcatccagtccttcgattcagctggcagcctgtgccacgaggaccac
atgctcaacatggtgctggccatgcacagctgggtgctgccgtccgccgacctggctgcc
cgcctgctgacctcataccagaaggccacaggggacacccaggagctgagacggctgcag
atctgtcacctggtcaggtactggctgatgcgacaccctgaggtgatgcaccaggatccc
cagctagaagaagtcataggtcgtttctgggccaccgtggcccgggagggcaactcagcc
cagagaagactgggagactcttctgacctcctgagccctggtggccctggccccccactc
ccaatgagcagcccaggcctgggcaaaaagcgcaaagtgtccttgcttttcgaccacttg
gagacgggggagctggctcagcacctcacctacctggagttccggtccttccaggctatc
acgccccaggacctgcggagctacgttttgcagggctcagtacgaggctgcccggccctg
gagggctccgtaggtctcagcaacagcgtgtcccgctgggtgcaggtgatggtgctgagc
cgtcccgggcccctacagcgtgcacaggtgctggacaagttcattcacgtggcacagagg
ctccaccagctgcagaatttcaacacgctgatggcagtcacagggggcctgtgtcacagt
gccatctccagactcaaggactcccatgcccacctgagccctgacagcaccaaggccctc
ctggagctcactgagctccttgcctcccacaacaactacgcccgctaccgccgcacctgg
gctggctgcgcgggtttccggctgcctgtactgggcgtgcacctcaaggacctggtgtcc
ctgcatgaggcacagcccgacaggttgcctgacggccgcctgcacctacccaagctgaac
aacctctacctgcggctgcaggagctggtggccctccaagggcagcatccaccctgcagc
gccaatgaggatctgctgcacctgctcacgctctccctggacctcttctacacggaagac
gagatctatgagctttcttatgcccgggagccgcgttgtcccaagagcctgccaccctcc
cccttcaatgcacctctggtggtggagtgggcccctggtgtgacacccaagccggacagg
gtcacactgggtcggcatgtggagcagctggtggagtctgtgttcaagaattatgaccct
gaaggccgaggaacaatctctcaggaggactttgagcgactctcgggcaattttcccttc
gcctgccatgggcttcacccacccccacgccaggggagaggatccttcagcagagaggag
ctgacagggtacctgctccgggccagcgccatctgctccaagttgggcctggccttcctg
cacaccttccatgaggtcaccttccgaaagcctaccttctgcgacagctgcagtggcttc
ctctggggtgtcaccaagcaaggctaccgctgtcgggagtgcgggctgtgttgccacaaa
cactgcagagaccaggtgaaggtagaatgtaagaagaggccaggggccaagggcgatgca
ggaccccccggagctcctgtcccatccacaccagctccccatgccagctgtggctccgag
gaaaatcactcctacacgctatccctggagcctgagactgggtgccagcttcgccatgcc
tggacccagactgaatccccacacccttcctgggaaacagatacggtcccctgcccggtg
atggacccaccatcaactgcatcctccaagctggattcctag

DBGET integrated database retrieval system